BLASTX nr result
ID: Glycyrrhiza34_contig00003667
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00003667 (747 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AGC78878.1 hypothetical protein (mitochondrion) [Vicia faba] AGC... 180 7e-55 AFK42885.1 unknown [Lotus japonicus] 173 4e-52 XP_016207714.1 PREDICTED: ATP synthase subunit 9, mitochondrial ... 69 2e-11 XP_015947650.1 PREDICTED: ATP synthase subunit 9, mitochondrial ... 67 3e-11 ACU30263.1 ATP synthase subunit 9, partial (mitochondrion) [Sile... 65 1e-10 ABV25303.1 ATP synthase subunit 9, partial (mitochondrion) [Sile... 65 1e-10 ABV25274.1 ATP synthase subunit 9, partial (mitochondrion) [Sile... 65 1e-10 ABV25236.1 ATP synthase subunit 9, partial (mitochondrion) [Sile... 65 1e-10 ABV25234.1 ATP synthase subunit 9, partial (mitochondrion) [Sile... 65 1e-10 AAW30248.1 ATP synthase F0 subunit 9, partial (mitochondrion) [A... 65 1e-10 AAW30242.1 ATP synthase F0 subunit 9, partial (mitochondrion) [P... 65 1e-10 EEF22810.1 ATP synthase 9 mitochondrial, putative, partial [Rici... 65 1e-10 KYP78439.1 hypothetical protein KK1_048242, partial [Cajanus cajan] 65 2e-10 KRX85853.1 ATP synthase subunit 9, mitochondrial, partial [Trich... 65 2e-10 ABH09172.1 ATP synthase subunit 9 (mitochondrion) [Silene uniflora] 65 2e-10 ABH09164.1 ATP synthase subunit 9 (mitochondrion) [Silene vulgar... 65 2e-10 ABH09165.1 ATP synthase subunit 9 (mitochondrion) [Silene vulgar... 65 2e-10 ABH09169.1 ATP synthase subunit 9 (mitochondrion) [Silene vulgar... 65 2e-10 EEF27214.1 conserved hypothetical protein [Ricinus communis] 65 2e-10 ANY30660.1 ATPase subunit 9, partial (mitochondrion) [Halodule w... 65 2e-10 >AGC78878.1 hypothetical protein (mitochondrion) [Vicia faba] AGC78917.1 hypothetical protein (mitochondrion) [Vicia faba] Length = 90 Score = 180 bits (456), Expect = 7e-55 Identities = 82/84 (97%), Positives = 82/84 (97%) Frame = -1 Query: 432 MKERDEFF*ICDVRRCKINRCRSCYNCFSGSCCRYWKRIQFINSFRGKKSIIGKTVIRIC 253 MKERDEFF I DVRRCKINRCRSCYNCFSGSCCRYWKRIQFINSFRGKKSIIGKTVIRIC Sbjct: 1 MKERDEFFSIRDVRRCKINRCRSCYNCFSGSCCRYWKRIQFINSFRGKKSIIGKTVIRIC 60 Query: 252 NPGLCSNRGYCLVRINDGLFDSIC 181 NPGLCSNRGYCLVRINDGLFDSIC Sbjct: 61 NPGLCSNRGYCLVRINDGLFDSIC 84 >AFK42885.1 unknown [Lotus japonicus] Length = 90 Score = 173 bits (438), Expect = 4e-52 Identities = 78/84 (92%), Positives = 80/84 (95%) Frame = -1 Query: 432 MKERDEFF*ICDVRRCKINRCRSCYNCFSGSCCRYWKRIQFINSFRGKKSIIGKTVIRIC 253 MKERD+ F I DVRRCKINRCRSCYNCFSGSCCRYWKRIQFINSFRGKKSIIGK VIRIC Sbjct: 1 MKERDDSFSIRDVRRCKINRCRSCYNCFSGSCCRYWKRIQFINSFRGKKSIIGKAVIRIC 60 Query: 252 NPGLCSNRGYCLVRINDGLFDSIC 181 NPGLCSNRGYCLVRINDGLFDS+C Sbjct: 61 NPGLCSNRGYCLVRINDGLFDSLC 84 >XP_016207714.1 PREDICTED: ATP synthase subunit 9, mitochondrial [Arachis ipaensis] Length = 104 Score = 68.6 bits (166), Expect = 2e-11 Identities = 40/72 (55%), Positives = 42/72 (58%) Frame = -2 Query: 443 KNRE*KSVTSFSKFVMLEXXXXXXXXXXXXXXXXXXXXXGNVFSSLIHSVARNPSLAKQL 264 +N +T KF MLE GNVFSSLIHSVARNPSLAKQL Sbjct: 16 RNENKHGMTRMEKFEMLEGAKSMGAGAATIASVGAAVGIGNVFSSLIHSVARNPSLAKQL 75 Query: 263 FGYAILGFALTE 228 FGYAILGFALTE Sbjct: 76 FGYAILGFALTE 87 >XP_015947650.1 PREDICTED: ATP synthase subunit 9, mitochondrial [Arachis duranensis] Length = 82 Score = 67.4 bits (163), Expect = 3e-11 Identities = 39/65 (60%), Positives = 40/65 (61%) Frame = -2 Query: 422 VTSFSKFVMLEXXXXXXXXXXXXXXXXXXXXXGNVFSSLIHSVARNPSLAKQLFGYAILG 243 +T KF MLE GNVFSSLIHSVARNPSLAKQLFGYAILG Sbjct: 1 MTRMEKFEMLEGAKSMGAGAATIASAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILG 60 Query: 242 FALTE 228 FALTE Sbjct: 61 FALTE 65 >ACU30263.1 ATP synthase subunit 9, partial (mitochondrion) [Silene delicatula] ACU30281.1 ATP synthase subunit 9, partial (mitochondrion) [Silene nana] Length = 56 Score = 65.1 bits (157), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 323 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 228 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >ABV25303.1 ATP synthase subunit 9, partial (mitochondrion) [Silene noctiflora] ACU30254.1 ATP synthase subunit 9, partial (mitochondrion) [Silene ammophila] ACU30260.1 ATP synthase subunit 9, partial (mitochondrion) [Silene conica] ACU30268.1 ATP synthase subunit 9, partial (mitochondrion) [Silene gallinyi] ACU30270.1 ATP synthase subunit 9, partial (mitochondrion) [Silene imbricata] ACU30277.1 ATP synthase subunit 9, partial (mitochondrion) [Silene macrodonta] ACU30282.1 ATP synthase subunit 9, partial (mitochondrion) [Silene niceensis] ACU30286.1 ATP synthase subunit 9, partial (mitochondrion) [Silene pygmaea] ACU30290.1 ATP synthase subunit 9, partial (mitochondrion) [Silene schafta] ACU30295.1 ATP synthase subunit 9, partial (mitochondrion) [Silene turkestanica] Length = 56 Score = 65.1 bits (157), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 323 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 228 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >ABV25274.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25275.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25276.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25277.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25278.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25279.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25280.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25281.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25282.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25283.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25284.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25285.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25286.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25287.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25288.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25289.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25290.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25291.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25292.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25293.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25294.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25295.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25296.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25297.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25298.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25299.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25300.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25301.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ACU30247.1 ATP synthase subunit 9, partial (mitochondrion) [Agrostemma githago] ACU30249.1 ATP synthase subunit 9, partial (mitochondrion) [Silene laeta] ACU30251.1 ATP synthase subunit 9, partial (mitochondrion) [Petrocoptis pyrenaica] ACU30252.1 ATP synthase subunit 9, partial (mitochondrion) [Silene acutifolia] ACU30253.1 ATP synthase subunit 9, partial (mitochondrion) [Silene akinfievii] ACU30261.1 ATP synthase subunit 9, partial (mitochondrion) [Silene cordifolia] ACU30269.1 ATP synthase subunit 9, partial (mitochondrion) [Silene hookeri] ACU30271.1 ATP synthase subunit 9, partial (mitochondrion) [Silene integripetala] ACU30273.1 ATP synthase subunit 9, partial (mitochondrion) [Silene khasiana] ACU30274.1 ATP synthase subunit 9, partial (mitochondrion) [Silene lacera] ACU30278.1 ATP synthase subunit 9, partial (mitochondrion) [Silene menziesii] ACU30292.1 ATP synthase subunit 9, partial (mitochondrion) [Silene sordida] Length = 56 Score = 65.1 bits (157), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 323 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 228 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >ABV25236.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ACU30296.1 ATP synthase subunit 9, partial (mitochondrion) [Silene uniflora] Length = 56 Score = 65.1 bits (157), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 323 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 228 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >ABV25234.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25235.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25237.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25238.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25239.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25240.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25242.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25243.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25244.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25245.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25246.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25247.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25248.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25249.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25250.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25251.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25252.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25253.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25254.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25255.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25256.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25258.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25260.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25261.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25262.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25263.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25264.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25265.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25266.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25267.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25268.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25269.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25270.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25271.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25272.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25273.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25302.1 ATP synthase subunit 9, partial (mitochondrion) [Silene acaulis] ABV25304.1 ATP synthase subunit 9, partial (mitochondrion) [Silene paradoxa] ABV25305.1 ATP synthase subunit 9, partial (mitochondrion) [Silene stellata] ABV25306.1 ATP synthase subunit 9, partial (mitochondrion) [Silene coronaria] ACU30248.1 ATP synthase subunit 9, partial (mitochondrion) [Atocion lerchenfeldianum] ACU30250.1 ATP synthase subunit 9, partial (mitochondrion) [Heliosperma pusillum] ACU30256.1 ATP synthase subunit 9, partial (mitochondrion) [Silene argentina] ACU30257.1 ATP synthase subunit 9, partial (mitochondrion) [Silene auriculata] ACU30258.1 ATP synthase subunit 9, partial (mitochondrion) [Silene caesia] ACU30262.1 ATP synthase subunit 9, partial (mitochondrion) [Silene davidii] ACU30264.1 ATP synthase subunit 9, partial (mitochondrion) [Silene dichotoma] ACU30265.1 ATP synthase subunit 9, partial (mitochondrion) [Silene douglasii] ACU30266.1 ATP synthase subunit 9, partial (mitochondrion) [Silene flavescens] ACU30267.1 ATP synthase subunit 9, partial (mitochondrion) [Silene fruticosa] ACU30272.1 ATP synthase subunit 9, partial (mitochondrion) [Silene involucrata] ACU30275.1 ATP synthase subunit 9, partial (mitochondrion) [Silene laciniata] ACU30276.1 ATP synthase subunit 9, partial (mitochondrion) [Silene littorea] ACU30279.1 ATP synthase subunit 9, partial (mitochondrion) [Silene multicaulis] ACU30280.1 ATP synthase subunit 9, partial (mitochondrion) [Silene muscipula] ACU30283.1 ATP synthase subunit 9, partial (mitochondrion) [Silene odontopetala] ACU30284.1 ATP synthase subunit 9, partial (mitochondrion) [Silene paradoxa] ACU30285.1 ATP synthase subunit 9, partial (mitochondrion) [Silene paucifolia] ACU30288.1 ATP synthase subunit 9, partial (mitochondrion) [Silene sachalinensis] ACU30291.1 ATP synthase subunit 9, partial (mitochondrion) [Silene seoulensis] ACU30298.1 ATP synthase subunit 9, partial (mitochondrion) [Silene yemensis] ACU30299.1 ATP synthase subunit 9, partial (mitochondrion) [Silene zawadskii] ACU30300.1 ATP synthase subunit 9, partial (mitochondrion) [Viscaria alpina] Length = 56 Score = 65.1 bits (157), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 323 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 228 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >AAW30248.1 ATP synthase F0 subunit 9, partial (mitochondrion) [Aloe vera] Length = 59 Score = 65.1 bits (157), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 323 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 228 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >AAW30242.1 ATP synthase F0 subunit 9, partial (mitochondrion) [Piper betle] Length = 59 Score = 65.1 bits (157), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 323 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 228 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >EEF22810.1 ATP synthase 9 mitochondrial, putative, partial [Ricinus communis] Length = 61 Score = 65.1 bits (157), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 323 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 228 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 26 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 57 >KYP78439.1 hypothetical protein KK1_048242, partial [Cajanus cajan] Length = 78 Score = 65.5 bits (158), Expect = 2e-10 Identities = 38/61 (62%), Positives = 39/61 (63%) Frame = -2 Query: 410 SKFVMLEXXXXXXXXXXXXXXXXXXXXXGNVFSSLIHSVARNPSLAKQLFGYAILGFALT 231 S+F MLE GNVFSSLIHSVARNPSLAKQLFGYAILGFALT Sbjct: 1 SQFEMLEGAKSMGAGAATIASAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALT 60 Query: 230 E 228 E Sbjct: 61 E 61 >KRX85853.1 ATP synthase subunit 9, mitochondrial, partial [Trichinella patagoniensis] Length = 65 Score = 65.1 bits (157), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 323 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 228 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 19 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 50 >ABH09172.1 ATP synthase subunit 9 (mitochondrion) [Silene uniflora] Length = 70 Score = 65.1 bits (157), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 323 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 228 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 26 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 57 >ABH09164.1 ATP synthase subunit 9 (mitochondrion) [Silene vulgaris] ABH09166.1 ATP synthase subunit 9 (mitochondrion) [Silene vulgaris] ABH09168.1 ATP synthase subunit 9 (mitochondrion) [Silene vulgaris] ABH09171.1 ATP synthase subunit 9 (mitochondrion) [Silene vulgaris] Length = 70 Score = 65.1 bits (157), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 323 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 228 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 26 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 57 >ABH09165.1 ATP synthase subunit 9 (mitochondrion) [Silene vulgaris] ABH09167.1 ATP synthase subunit 9 (mitochondrion) [Silene vulgaris] Length = 70 Score = 65.1 bits (157), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 323 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 228 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 26 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 57 >ABH09169.1 ATP synthase subunit 9 (mitochondrion) [Silene vulgaris] ABH09173.1 ATP synthase subunit 9 (mitochondrion) [Silene latifolia] Length = 70 Score = 65.1 bits (157), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 323 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 228 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 26 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 57 >EEF27214.1 conserved hypothetical protein [Ricinus communis] Length = 84 Score = 65.5 bits (158), Expect = 2e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 4 VYRAFTMSPEQFQYIWRKTIPHIEVGMGSGVF 99 +YRA+TMSPEQ QYIWRKTIPHIEVGMGSGVF Sbjct: 40 LYRAWTMSPEQSQYIWRKTIPHIEVGMGSGVF 71 >ANY30660.1 ATPase subunit 9, partial (mitochondrion) [Halodule wrightii] Length = 72 Score = 65.1 bits (157), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 323 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 228 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 24 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 55