BLASTX nr result
ID: Glycyrrhiza34_contig00003532
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00003532 (248 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU15209.1 hypothetical protein TSUD_09470 [Trifolium subterraneum] 55 6e-08 ACJ84059.1 unknown [Medicago truncatula] 55 1e-07 XP_003588654.1 hypothetical protein MTR_1g009640 [Medicago trunc... 55 6e-07 XP_003590170.1 oligopeptide transporter-like protein [Medicago t... 52 5e-06 >GAU15209.1 hypothetical protein TSUD_09470 [Trifolium subterraneum] Length = 122 Score = 55.5 bits (132), Expect = 6e-08 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +1 Query: 148 MDILVGPTFAVDVPSSPPPYAGDRPTGNVFFAG 246 MD++VGPTF++DVP+S PP+AG+RP GNVFF G Sbjct: 1 MDVMVGPTFSIDVPTS-PPFAGNRPNGNVFFTG 32 >ACJ84059.1 unknown [Medicago truncatula] Length = 114 Score = 54.7 bits (130), Expect = 1e-07 Identities = 24/34 (70%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Frame = +1 Query: 148 MDILVGPTFAVDVPSSPP-PYAGDRPTGNVFFAG 246 MD++VGPTF++DVPSSPP AG+RP+GNVFF+G Sbjct: 1 MDVMVGPTFSIDVPSSPPFAGAGNRPSGNVFFSG 34 >XP_003588654.1 hypothetical protein MTR_1g009640 [Medicago truncatula] AES58905.1 hypothetical protein MTR_1g009640 [Medicago truncatula] Length = 245 Score = 54.7 bits (130), Expect = 6e-07 Identities = 24/34 (70%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Frame = +1 Query: 148 MDILVGPTFAVDVPSSPP-PYAGDRPTGNVFFAG 246 MD++VGPTF++DVPSSPP AG+RP+GNVFF+G Sbjct: 1 MDVMVGPTFSIDVPSSPPFAGAGNRPSGNVFFSG 34 >XP_003590170.1 oligopeptide transporter-like protein [Medicago truncatula] AES60421.1 oligopeptide transporter-like protein [Medicago truncatula] Length = 183 Score = 51.6 bits (122), Expect = 5e-06 Identities = 20/30 (66%), Positives = 26/30 (86%) Frame = +1 Query: 157 LVGPTFAVDVPSSPPPYAGDRPTGNVFFAG 246 +V P+F++D PSSPPP+A + PTGNVFFAG Sbjct: 1 MVSPSFSIDAPSSPPPFAENHPTGNVFFAG 30