BLASTX nr result
ID: Glycyrrhiza33_contig00020471
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00020471 (343 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004488613.1 PREDICTED: protein ASPARTIC PROTEASE IN GUARD CEL... 90 1e-18 GAU38039.1 hypothetical protein TSUD_274410 [Trifolium subterran... 86 4e-17 KYP40436.1 Aspartic proteinase nepenthesin-1, partial [Cajanus c... 85 5e-17 XP_016171162.1 PREDICTED: protein ASPARTIC PROTEASE IN GUARD CEL... 83 3e-16 XP_015932512.1 PREDICTED: protein ASPARTIC PROTEASE IN GUARD CEL... 83 3e-16 OIV92528.1 hypothetical protein TanjilG_02291 [Lupinus angustifo... 82 5e-16 XP_019425702.1 PREDICTED: aspartic proteinase nepenthesin-1-like... 82 5e-16 XP_014502326.1 PREDICTED: protein ASPARTIC PROTEASE IN GUARD CEL... 82 6e-16 XP_017423262.1 PREDICTED: aspartyl protease family protein 2 [Vi... 82 6e-16 XP_013464163.1 eukaryotic aspartyl protease family protein [Medi... 81 1e-15 XP_003532899.1 PREDICTED: protein ASPARTIC PROTEASE IN GUARD CEL... 81 2e-15 KHN21360.1 Aspartic proteinase nepenthesin-1 [Glycine soja] 80 2e-15 XP_006598230.1 PREDICTED: aspartic proteinase nepenthesin-1-like... 80 2e-15 XP_019443669.1 PREDICTED: protein ASPARTIC PROTEASE IN GUARD CEL... 79 1e-14 XP_007149149.1 hypothetical protein PHAVU_005G045500g [Phaseolus... 74 6e-13 XP_010092446.1 Aspartic proteinase nepenthesin-1 [Morus notabili... 68 5e-11 XP_016705469.1 PREDICTED: aspartic proteinase nepenthesin-1-like... 66 2e-10 XP_016674071.1 PREDICTED: aspartic proteinase CDR1-like [Gossypi... 66 2e-10 XP_012463657.1 PREDICTED: aspartic proteinase nepenthesin-1 [Gos... 66 2e-10 XP_017620059.1 PREDICTED: aspartic proteinase CDR1 [Gossypium ar... 66 2e-10 >XP_004488613.1 PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Cicer arietinum] Length = 501 Score = 89.7 bits (221), Expect = 1e-18 Identities = 43/62 (69%), Positives = 47/62 (75%) Frame = -1 Query: 301 RRKDSEINLXXXXXXXQFKMPMHAGRDLKLGEYFVQVKVGTPGQKFWLVADTGSEFTWFN 122 RRKD E QF+MPMH+GRD LGEYFV VK+G+PGQ FWLVADTGSEFTWFN Sbjct: 89 RRKDIETQ--------QFQMPMHSGRDYALGEYFVGVKIGSPGQSFWLVADTGSEFTWFN 140 Query: 121 CK 116 CK Sbjct: 141 CK 142 >GAU38039.1 hypothetical protein TSUD_274410 [Trifolium subterraneum] Length = 500 Score = 85.5 bits (210), Expect = 4e-17 Identities = 38/61 (62%), Positives = 47/61 (77%) Frame = -1 Query: 301 RRKDSEINLXXXXXXXQFKMPMHAGRDLKLGEYFVQVKVGTPGQKFWLVADTGSEFTWFN 122 RRKD E+ QF++PM +GRD KLGEYFV V+VGTPGQ+FW++ADTG+E TWFN Sbjct: 70 RRKDIEMKSHDIEAQPQFQLPMLSGRDEKLGEYFVDVEVGTPGQRFWVIADTGNELTWFN 129 Query: 121 C 119 C Sbjct: 130 C 130 >KYP40436.1 Aspartic proteinase nepenthesin-1, partial [Cajanus cajan] Length = 398 Score = 84.7 bits (208), Expect = 5e-17 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -1 Query: 247 KMPMHAGRDLKLGEYFVQVKVGTPGQKFWLVADTGSEFTWFNC 119 +MPM +GRD LGEYFV+VKVGTPGQ FWLVADTGSEFTWFNC Sbjct: 5 QMPMQSGRDYSLGEYFVEVKVGTPGQPFWLVADTGSEFTWFNC 47 >XP_016171162.1 PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Arachis ipaensis] Length = 527 Score = 83.2 bits (204), Expect = 3e-16 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -1 Query: 250 FKMPMHAGRDLKLGEYFVQVKVGTPGQKFWLVADTGSEFTWFNCKEE 110 F+MPM +GRD LGEYFVQV+VGTPGQKFW+VADTG+E TWFNC ++ Sbjct: 116 FEMPMQSGRDNGLGEYFVQVEVGTPGQKFWVVADTGNELTWFNCLDK 162 >XP_015932512.1 PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Arachis duranensis] Length = 527 Score = 83.2 bits (204), Expect = 3e-16 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -1 Query: 250 FKMPMHAGRDLKLGEYFVQVKVGTPGQKFWLVADTGSEFTWFNCKEE 110 F+MPM +GRD LGEYFVQV+VGTPGQKFW+VADTG+E TWFNC ++ Sbjct: 116 FEMPMQSGRDNGLGEYFVQVEVGTPGQKFWVVADTGNELTWFNCLDK 162 >OIV92528.1 hypothetical protein TanjilG_02291 [Lupinus angustifolius] Length = 516 Score = 82.4 bits (202), Expect = 5e-16 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -1 Query: 250 FKMPMHAGRDLKLGEYFVQVKVGTPGQKFWLVADTGSEFTWFNCKE 113 F+M MHAG D GEYFVQV+VGTP QKFWLVADTG+E TWFNCK+ Sbjct: 102 FQMSMHAGADYGFGEYFVQVQVGTPSQKFWLVADTGNELTWFNCKD 147 >XP_019425702.1 PREDICTED: aspartic proteinase nepenthesin-1-like [Lupinus angustifolius] Length = 518 Score = 82.4 bits (202), Expect = 5e-16 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -1 Query: 250 FKMPMHAGRDLKLGEYFVQVKVGTPGQKFWLVADTGSEFTWFNCKE 113 F+M MHAG D GEYFVQV+VGTP QKFWLVADTG+E TWFNCK+ Sbjct: 104 FQMSMHAGADYGFGEYFVQVQVGTPSQKFWLVADTGNELTWFNCKD 149 >XP_014502326.1 PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Vigna radiata var. radiata] Length = 518 Score = 82.0 bits (201), Expect = 6e-16 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -1 Query: 247 KMPMHAGRDLKLGEYFVQVKVGTPGQKFWLVADTGSEFTWFNC 119 +MPM GRDL +GEYFV+VKVGTPGQK WL ADTGSEFTWFNC Sbjct: 107 EMPMLTGRDLGIGEYFVEVKVGTPGQKLWLAADTGSEFTWFNC 149 >XP_017423262.1 PREDICTED: aspartyl protease family protein 2 [Vigna angularis] KOM42784.1 hypothetical protein LR48_Vigan05g038800 [Vigna angularis] BAT93107.1 hypothetical protein VIGAN_07200900 [Vigna angularis var. angularis] Length = 518 Score = 82.0 bits (201), Expect = 6e-16 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -1 Query: 247 KMPMHAGRDLKLGEYFVQVKVGTPGQKFWLVADTGSEFTWFNC 119 +MP+ GRDL +GEYFVQVKVGTPGQK WL ADTGSEFTWFNC Sbjct: 105 EMPLLTGRDLGIGEYFVQVKVGTPGQKLWLAADTGSEFTWFNC 147 >XP_013464163.1 eukaryotic aspartyl protease family protein [Medicago truncatula] KEH38198.1 eukaryotic aspartyl protease family protein [Medicago truncatula] Length = 509 Score = 81.3 bits (199), Expect = 1e-15 Identities = 37/64 (57%), Positives = 46/64 (71%) Frame = -1 Query: 301 RRKDSEINLXXXXXXXQFKMPMHAGRDLKLGEYFVQVKVGTPGQKFWLVADTGSEFTWFN 122 RRKD E+ F+ MH+GRD+++GEYFV V VGTPGQKFWL+ADTGSE TWF Sbjct: 94 RRKDIEMK-------QDFEFSMHSGRDVEIGEYFVGVTVGTPGQKFWLIADTGSELTWFK 146 Query: 121 CKEE 110 C ++ Sbjct: 147 CMKK 150 >XP_003532899.1 PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine max] KRH43644.1 hypothetical protein GLYMA_08G162100 [Glycine max] Length = 507 Score = 80.9 bits (198), Expect = 2e-15 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -1 Query: 247 KMPMHAGRDLKLGEYFVQVKVGTPGQKFWLVADTGSEFTWFNC 119 +MPM AGRD LGEYF +VKVG+PGQ+FWL ADTGSEFTWFNC Sbjct: 97 EMPMRAGRDDALGEYFTEVKVGSPGQRFWLAADTGSEFTWFNC 139 >KHN21360.1 Aspartic proteinase nepenthesin-1 [Glycine soja] Length = 410 Score = 80.5 bits (197), Expect = 2e-15 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -1 Query: 244 MPMHAGRDLKLGEYFVQVKVGTPGQKFWLVADTGSEFTWFNC 119 MPM AGRD LGEYF +VKVG+PGQ+FWL ADTGSEFTWFNC Sbjct: 1 MPMRAGRDDALGEYFTEVKVGSPGQRFWLAADTGSEFTWFNC 42 >XP_006598230.1 PREDICTED: aspartic proteinase nepenthesin-1-like [Glycine max] KRH13812.1 hypothetical protein GLYMA_15G265500 [Glycine max] Length = 521 Score = 80.5 bits (197), Expect = 2e-15 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -1 Query: 247 KMPMHAGRDLKLGEYFVQVKVGTPGQKFWLVADTGSEFTWFNC 119 +MPMH+GRD LGEYF +VKVG+PGQ+FWLV DTGSEFTW NC Sbjct: 100 EMPMHSGRDDALGEYFAEVKVGSPGQRFWLVVDTGSEFTWLNC 142 >XP_019443669.1 PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Lupinus angustifolius] OIW11713.1 hypothetical protein TanjilG_12232 [Lupinus angustifolius] Length = 520 Score = 78.6 bits (192), Expect = 1e-14 Identities = 38/63 (60%), Positives = 43/63 (68%) Frame = -1 Query: 301 RRKDSEINLXXXXXXXQFKMPMHAGRDLKLGEYFVQVKVGTPGQKFWLVADTGSEFTWFN 122 RRKD E F+M MHAG D LGEYFVQV VG+P QK WL+ADTG+E TWFN Sbjct: 102 RRKDFET----------FQMSMHAGADYGLGEYFVQVGVGSPSQKLWLLADTGNELTWFN 151 Query: 121 CKE 113 CK+ Sbjct: 152 CKD 154 >XP_007149149.1 hypothetical protein PHAVU_005G045500g [Phaseolus vulgaris] ESW21143.1 hypothetical protein PHAVU_005G045500g [Phaseolus vulgaris] Length = 505 Score = 73.6 bits (179), Expect = 6e-13 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -1 Query: 247 KMPMHAGRDLKLGEYFVQVKVGTPGQKFWLVADTGSEFTWFN 122 +MP+ GRD+ +GEYFV+VKVG+PGQ+ WL ADTGSEFTWFN Sbjct: 97 EMPLLTGRDMGIGEYFVEVKVGSPGQRVWLAADTGSEFTWFN 138 >XP_010092446.1 Aspartic proteinase nepenthesin-1 [Morus notabilis] EXB51212.1 Aspartic proteinase nepenthesin-1 [Morus notabilis] Length = 464 Score = 68.2 bits (165), Expect = 5e-11 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -1 Query: 244 MPMHAGRDLKLGEYFVQVKVGTPGQKFWLVADTGSEFTWFNCK 116 MPM+AG D +GEYFV V VGTPGQ+F LVADTGS+ TW +C+ Sbjct: 83 MPMNAGADYGVGEYFVHVTVGTPGQRFMLVADTGSDLTWMHCR 125 >XP_016705469.1 PREDICTED: aspartic proteinase nepenthesin-1-like [Gossypium hirsutum] Length = 473 Score = 66.2 bits (160), Expect = 2e-10 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = -1 Query: 247 KMPMHAGRDLKLGEYFVQVKVGTPGQKFWLVADTGSEFTWFNCK 116 KMP+ +GRD +G+Y KVGTP QKFWL+ DTGS+ TW C+ Sbjct: 91 KMPLASGRDFGIGQYITSFKVGTPSQKFWLIVDTGSDLTWIRCR 134 >XP_016674071.1 PREDICTED: aspartic proteinase CDR1-like [Gossypium hirsutum] Length = 473 Score = 66.2 bits (160), Expect = 2e-10 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = -1 Query: 247 KMPMHAGRDLKLGEYFVQVKVGTPGQKFWLVADTGSEFTWFNCK 116 KMP+ +GRD +G+Y KVGTP QKFWL+ DTGS+ TW C+ Sbjct: 91 KMPLASGRDFGIGQYITSFKVGTPSQKFWLIVDTGSDLTWIRCR 134 >XP_012463657.1 PREDICTED: aspartic proteinase nepenthesin-1 [Gossypium raimondii] KJB81478.1 hypothetical protein B456_013G147300 [Gossypium raimondii] Length = 473 Score = 66.2 bits (160), Expect = 2e-10 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = -1 Query: 247 KMPMHAGRDLKLGEYFVQVKVGTPGQKFWLVADTGSEFTWFNCK 116 KMP+ +GRD +G+Y KVGTP QKFWL+ DTGS+ TW C+ Sbjct: 91 KMPLASGRDFGIGQYITSFKVGTPSQKFWLIVDTGSDLTWIRCR 134 >XP_017620059.1 PREDICTED: aspartic proteinase CDR1 [Gossypium arboreum] KHG15209.1 Asparticase nepenthesin-1 [Gossypium arboreum] Length = 473 Score = 66.2 bits (160), Expect = 2e-10 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = -1 Query: 247 KMPMHAGRDLKLGEYFVQVKVGTPGQKFWLVADTGSEFTWFNCK 116 KMP+ +GRD +G+Y KVGTP QKFWL+ DTGS+ TW C+ Sbjct: 91 KMPLASGRDFGIGQYITSFKVGTPSQKFWLIVDTGSDLTWIRCR 134