BLASTX nr result
ID: Glycyrrhiza33_contig00020393
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00020393 (362 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003592086.2 cellulose synthase-like protein [Medicago truncat... 65 1e-09 XP_013469611.1 cellulose synthase-like protein [Medicago truncat... 65 1e-09 XP_014513785.1 PREDICTED: cellulose synthase A catalytic subunit... 64 2e-09 XP_017415092.1 PREDICTED: cellulose synthase A catalytic subunit... 64 2e-09 XP_007143558.1 hypothetical protein PHAVU_007G081700g [Phaseolus... 64 2e-09 XP_016175888.1 PREDICTED: cellulose synthase A catalytic subunit... 64 2e-09 XP_015942548.1 PREDICTED: cellulose synthase A catalytic subunit... 64 2e-09 XP_014618828.1 PREDICTED: cellulose synthase A catalytic subunit... 61 2e-08 XP_003536418.1 PREDICTED: cellulose synthase A catalytic subunit... 61 2e-08 KRH35122.1 hypothetical protein GLYMA_10G223500 [Glycine max] 61 2e-08 KHN41284.1 Cellulose synthase A catalytic subunit 6 [UDP-forming... 60 4e-08 KRH08678.1 hypothetical protein GLYMA_16G165900 [Glycine max] 60 4e-08 XP_003548102.1 PREDICTED: cellulose synthase A catalytic subunit... 60 4e-08 KYP45964.1 Cellulose synthase A catalytic subunit 6 [UDP-forming... 60 4e-08 XP_012080728.1 PREDICTED: cellulose synthase A catalytic subunit... 60 4e-08 AFV91446.1 cellulose synthase CesA2, partial [Salix phylicifolia] 55 5e-08 AFV91430.1 cellulose synthase CesA2, partial [Salix schwerinii x... 55 6e-08 AFV91448.1 cellulose synthase CesA2, partial [Populus tremula] 55 6e-08 AFV91432.1 cellulose synthase CesA2, partial [Salix dasyclados] 55 6e-08 AFV91426.1 cellulose synthase CesA2, partial [Salix hybrid culti... 55 6e-08 >XP_003592086.2 cellulose synthase-like protein [Medicago truncatula] AES62337.2 cellulose synthase-like protein [Medicago truncatula] Length = 1093 Score = 64.7 bits (156), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 361 ASIFSLLWVRINPFLSKNDIVLELCGLNCD 272 ASIFSLLWVRINPF+SKNDIVLELCGLNCD Sbjct: 1064 ASIFSLLWVRINPFVSKNDIVLELCGLNCD 1093 >XP_013469611.1 cellulose synthase-like protein [Medicago truncatula] KEH43649.1 cellulose synthase-like protein [Medicago truncatula] Length = 1097 Score = 64.7 bits (156), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 361 ASIFSLLWVRINPFLSKNDIVLELCGLNCD 272 ASIFSLLWVRINPF+SKNDIVLELCGLNCD Sbjct: 1068 ASIFSLLWVRINPFVSKNDIVLELCGLNCD 1097 >XP_014513785.1 PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Vigna radiata var. radiata] Length = 1093 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 361 ASIFSLLWVRINPFLSKNDIVLELCGLNCD 272 ASIFSLLWVRINPFLSK+DIVLELCGLNCD Sbjct: 1064 ASIFSLLWVRINPFLSKDDIVLELCGLNCD 1093 >XP_017415092.1 PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Vigna angularis] KOM35865.1 hypothetical protein LR48_Vigan02g201500 [Vigna angularis] BAT94328.1 hypothetical protein VIGAN_08092400 [Vigna angularis var. angularis] Length = 1093 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 361 ASIFSLLWVRINPFLSKNDIVLELCGLNCD 272 ASIFSLLWVRINPFLSK+DIVLELCGLNCD Sbjct: 1064 ASIFSLLWVRINPFLSKDDIVLELCGLNCD 1093 >XP_007143558.1 hypothetical protein PHAVU_007G081700g [Phaseolus vulgaris] ESW15552.1 hypothetical protein PHAVU_007G081700g [Phaseolus vulgaris] Length = 1093 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 361 ASIFSLLWVRINPFLSKNDIVLELCGLNCD 272 ASIFSLLWVRINPFLSK+DIVLELCGLNCD Sbjct: 1064 ASIFSLLWVRINPFLSKDDIVLELCGLNCD 1093 >XP_016175888.1 PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Arachis ipaensis] Length = 1098 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 361 ASIFSLLWVRINPFLSKNDIVLELCGLNCD 272 ASIFSLLWVRINPFLSK+DIVLELCGLNCD Sbjct: 1068 ASIFSLLWVRINPFLSKSDIVLELCGLNCD 1097 >XP_015942548.1 PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Arachis duranensis] Length = 1098 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 361 ASIFSLLWVRINPFLSKNDIVLELCGLNCD 272 ASIFSLLWVRINPFLSK+DIVLELCGLNCD Sbjct: 1068 ASIFSLLWVRINPFLSKSDIVLELCGLNCD 1097 >XP_014618828.1 PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like isoform X2 [Glycine max] Length = 911 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 361 ASIFSLLWVRINPFLSKNDIVLELCGLNCD 272 ASIFSLLWVRINPFLSK IVLELCGLNCD Sbjct: 882 ASIFSLLWVRINPFLSKGGIVLELCGLNCD 911 >XP_003536418.1 PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like isoform X1 [Glycine max] KHN17022.1 Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine soja] KRH35121.1 hypothetical protein GLYMA_10G223500 [Glycine max] Length = 1095 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 361 ASIFSLLWVRINPFLSKNDIVLELCGLNCD 272 ASIFSLLWVRINPFLSK IVLELCGLNCD Sbjct: 1066 ASIFSLLWVRINPFLSKGGIVLELCGLNCD 1095 >KRH35122.1 hypothetical protein GLYMA_10G223500 [Glycine max] Length = 1097 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 361 ASIFSLLWVRINPFLSKNDIVLELCGLNCD 272 ASIFSLLWVRINPFLSK IVLELCGLNCD Sbjct: 1068 ASIFSLLWVRINPFLSKGGIVLELCGLNCD 1097 >KHN41284.1 Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine soja] Length = 847 Score = 60.1 bits (144), Expect = 4e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 361 ASIFSLLWVRINPFLSKNDIVLELCGLNCD 272 ASI +LLWVRINPFL+KND+VLE+CGLNCD Sbjct: 818 ASILTLLWVRINPFLAKNDVVLEICGLNCD 847 >KRH08678.1 hypothetical protein GLYMA_16G165900 [Glycine max] Length = 897 Score = 60.1 bits (144), Expect = 4e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 361 ASIFSLLWVRINPFLSKNDIVLELCGLNCD 272 ASI +LLWVRINPFL+KND+VLE+CGLNCD Sbjct: 868 ASILTLLWVRINPFLAKNDVVLEICGLNCD 897 >XP_003548102.1 PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Glycine max] KRH08677.1 hypothetical protein GLYMA_16G165900 [Glycine max] Length = 1078 Score = 60.1 bits (144), Expect = 4e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 361 ASIFSLLWVRINPFLSKNDIVLELCGLNCD 272 ASI +LLWVRINPFL+KND+VLE+CGLNCD Sbjct: 1049 ASILTLLWVRINPFLAKNDVVLEICGLNCD 1078 >KYP45964.1 Cellulose synthase A catalytic subunit 6 [UDP-forming] [Cajanus cajan] Length = 1088 Score = 60.1 bits (144), Expect = 4e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 361 ASIFSLLWVRINPFLSKNDIVLELCGLNCD 272 ASI +LLWVRINPFL+KND+VLE+CGLNCD Sbjct: 1059 ASILTLLWVRINPFLAKNDVVLEICGLNCD 1088 >XP_012080728.1 PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Jatropha curcas] KDP30751.1 hypothetical protein JCGZ_15180 [Jatropha curcas] Length = 1092 Score = 60.1 bits (144), Expect = 4e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 361 ASIFSLLWVRINPFLSKNDIVLELCGLNCD 272 ASIFSLLWVR+NPFLSK+ IVLE+CGLNCD Sbjct: 1063 ASIFSLLWVRVNPFLSKDGIVLEICGLNCD 1092 >AFV91446.1 cellulose synthase CesA2, partial [Salix phylicifolia] Length = 50 Score = 55.1 bits (131), Expect = 5e-08 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 361 ASIFSLLWVRINPFLSKNDIVLELCGLNCD 272 AS+ +LLWVRINPF+SK IVLE+CGLNCD Sbjct: 21 ASVLTLLWVRINPFVSKGGIVLEICGLNCD 50 >AFV91430.1 cellulose synthase CesA2, partial [Salix schwerinii x Salix viminalis] Length = 54 Score = 55.1 bits (131), Expect = 6e-08 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 361 ASIFSLLWVRINPFLSKNDIVLELCGLNCD 272 AS+ +LLWVRINPF+SK IVLE+CGLNCD Sbjct: 25 ASVLTLLWVRINPFVSKGGIVLEICGLNCD 54 >AFV91448.1 cellulose synthase CesA2, partial [Populus tremula] Length = 55 Score = 55.1 bits (131), Expect = 6e-08 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 361 ASIFSLLWVRINPFLSKNDIVLELCGLNCD 272 AS+ +LLWVRINPF+SK IVLE+CGLNCD Sbjct: 26 ASVLTLLWVRINPFVSKGGIVLEICGLNCD 55 >AFV91432.1 cellulose synthase CesA2, partial [Salix dasyclados] Length = 55 Score = 55.1 bits (131), Expect = 6e-08 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 361 ASIFSLLWVRINPFLSKNDIVLELCGLNCD 272 AS+ +LLWVRINPF+SK IVLE+CGLNCD Sbjct: 26 ASVLTLLWVRINPFVSKGGIVLEICGLNCD 55 >AFV91426.1 cellulose synthase CesA2, partial [Salix hybrid cultivar] AFV91427.1 cellulose synthase CesA2, partial [Salix triandra x Salix viminalis] AFV91428.1 cellulose synthase CesA2, partial [Salix hybrid cultivar] AFV91429.1 cellulose synthase CesA2, partial [Salix hybrid cultivar] AFV91434.1 cellulose synthase CesA2, partial [Salix x smithiana] AFV91435.1 cellulose synthase CesA2, partial [Salix caprea] AFV91436.1 cellulose synthase CesA2, partial [Salix viminalis] AFV91440.1 cellulose synthase CesA2, partial [Salix aurita] AFV91443.1 cellulose synthase CesA2, partial [Salix x erdingeri] AFV91444.1 cellulose synthase CesA2, partial [Salix gracilistyla] AFV91445.1 cellulose synthase CesA2, partial [Salix glabra] AFV91447.1 cellulose synthase CesA2, partial [Salix x fragilis] Length = 56 Score = 55.1 bits (131), Expect = 6e-08 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 361 ASIFSLLWVRINPFLSKNDIVLELCGLNCD 272 AS+ +LLWVRINPF+SK IVLE+CGLNCD Sbjct: 27 ASVLTLLWVRINPFVSKGGIVLEICGLNCD 56