BLASTX nr result
ID: Glycyrrhiza33_contig00020345
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00020345 (468 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOM38068.1 hypothetical protein LR48_Vigan03g145000 [Vigna angul... 119 1e-31 XP_017419318.1 PREDICTED: tropinone reductase homolog [Vigna ang... 119 3e-30 KHN40273.1 Tropinone reductase like [Glycine soja] 119 3e-30 XP_003529117.1 PREDICTED: tropinone reductase homolog At5g06060-... 119 3e-30 KRH49156.1 hypothetical protein GLYMA_07G136400 [Glycine max] 116 5e-30 XP_014633470.1 PREDICTED: tropinone reductase homolog [Glycine max] 116 6e-30 XP_004492175.1 PREDICTED: tropinone reductase homolog At5g06060-... 118 9e-30 XP_017416163.1 PREDICTED: tropinone reductase homolog [Vigna ang... 117 2e-29 XP_013448955.1 enoyl-(acyl carrier) reductase [Medicago truncatu... 117 2e-29 ABO37800.1 oxidoreductase-like protein, partial [Pisum sativum] 114 3e-29 XP_007140487.1 hypothetical protein PHAVU_008G116700g [Phaseolus... 113 3e-29 XP_014498115.1 PREDICTED: tropinone reductase homolog [Vigna rad... 116 3e-29 XP_007140480.1 hypothetical protein PHAVU_008G116200g [Phaseolus... 116 5e-29 XP_007140477.1 hypothetical protein PHAVU_008G115900g [Phaseolus... 116 5e-29 GAU37906.1 hypothetical protein TSUD_163430 [Trifolium subterran... 115 7e-29 XP_014497093.1 PREDICTED: tropinone reductase homolog [Vigna rad... 115 7e-29 XP_007140488.1 hypothetical protein PHAVU_008G116700g [Phaseolus... 113 9e-29 KHN04072.1 Tropinone reductase like [Glycine soja] 114 1e-28 XP_014514897.1 PREDICTED: tropinone reductase homolog [Vigna rad... 115 1e-28 NP_001237661.1 uncharacterized protein LOC100306108 [Glycine max... 114 2e-28 >KOM38068.1 hypothetical protein LR48_Vigan03g145000 [Vigna angularis] Length = 142 Score = 119 bits (298), Expect = 1e-31 Identities = 57/65 (87%), Positives = 61/65 (93%) Frame = +1 Query: 1 LAHPLLKASGYGSIVFISSISGLKALPLCSIYAASKGAMNLFTKNVALEWAKDNIRANVV 180 LAHPLLKASGYG+IVFISSISGLKA PLC+ YAASKGA+N FTKN+ALEWAKDNIRAN V Sbjct: 14 LAHPLLKASGYGNIVFISSISGLKAFPLCTAYAASKGALNQFTKNIALEWAKDNIRANAV 73 Query: 181 APGPV 195 APGPV Sbjct: 74 APGPV 78 >XP_017419318.1 PREDICTED: tropinone reductase homolog [Vigna angularis] BAT84505.1 hypothetical protein VIGAN_04190400 [Vigna angularis var. angularis] Length = 265 Score = 119 bits (298), Expect = 3e-30 Identities = 57/65 (87%), Positives = 61/65 (93%) Frame = +1 Query: 1 LAHPLLKASGYGSIVFISSISGLKALPLCSIYAASKGAMNLFTKNVALEWAKDNIRANVV 180 LAHPLLKASGYG+IVFISSISGLKA PLC+ YAASKGA+N FTKN+ALEWAKDNIRAN V Sbjct: 137 LAHPLLKASGYGNIVFISSISGLKAFPLCTAYAASKGALNQFTKNIALEWAKDNIRANAV 196 Query: 181 APGPV 195 APGPV Sbjct: 197 APGPV 201 >KHN40273.1 Tropinone reductase like [Glycine soja] Length = 266 Score = 119 bits (298), Expect = 3e-30 Identities = 58/65 (89%), Positives = 60/65 (92%) Frame = +1 Query: 1 LAHPLLKASGYGSIVFISSISGLKALPLCSIYAASKGAMNLFTKNVALEWAKDNIRANVV 180 LAHPLLKASGYGSIVFISSI+GLKALPLCSIY SKGAMN TKN+ALEWAKDNIRAN V Sbjct: 137 LAHPLLKASGYGSIVFISSIAGLKALPLCSIYGPSKGAMNQLTKNIALEWAKDNIRANTV 196 Query: 181 APGPV 195 APGPV Sbjct: 197 APGPV 201 >XP_003529117.1 PREDICTED: tropinone reductase homolog At5g06060-like [Glycine max] KRH49153.1 hypothetical protein GLYMA_07G136200 [Glycine max] Length = 266 Score = 119 bits (298), Expect = 3e-30 Identities = 58/65 (89%), Positives = 60/65 (92%) Frame = +1 Query: 1 LAHPLLKASGYGSIVFISSISGLKALPLCSIYAASKGAMNLFTKNVALEWAKDNIRANVV 180 LAHPLLKASGYGSIVFISSI+GLKALPLCSIY SKGAMN TKN+ALEWAKDNIRAN V Sbjct: 137 LAHPLLKASGYGSIVFISSIAGLKALPLCSIYGPSKGAMNQLTKNIALEWAKDNIRANTV 196 Query: 181 APGPV 195 APGPV Sbjct: 197 APGPV 201 >KRH49156.1 hypothetical protein GLYMA_07G136400 [Glycine max] Length = 171 Score = 116 bits (290), Expect = 5e-30 Identities = 55/65 (84%), Positives = 60/65 (92%) Frame = +1 Query: 1 LAHPLLKASGYGSIVFISSISGLKALPLCSIYAASKGAMNLFTKNVALEWAKDNIRANVV 180 LAHPLLKASGYG IVFISSI+GLKA P+CS+YAASKGA+N FTKN+ALEWAKDNIRAN V Sbjct: 43 LAHPLLKASGYGRIVFISSIAGLKAFPICSVYAASKGALNQFTKNIALEWAKDNIRANTV 102 Query: 181 APGPV 195 APG V Sbjct: 103 APGAV 107 >XP_014633470.1 PREDICTED: tropinone reductase homolog [Glycine max] Length = 180 Score = 116 bits (290), Expect = 6e-30 Identities = 55/65 (84%), Positives = 60/65 (92%) Frame = +1 Query: 1 LAHPLLKASGYGSIVFISSISGLKALPLCSIYAASKGAMNLFTKNVALEWAKDNIRANVV 180 LAHPLLKASGYG IVFISSI+GLKA P+CS+YAASKGA+N FTKN+ALEWAKDNIRAN V Sbjct: 52 LAHPLLKASGYGRIVFISSIAGLKAFPICSVYAASKGALNQFTKNIALEWAKDNIRANTV 111 Query: 181 APGPV 195 APG V Sbjct: 112 APGAV 116 >XP_004492175.1 PREDICTED: tropinone reductase homolog At5g06060-like [Cicer arietinum] Length = 265 Score = 118 bits (295), Expect = 9e-30 Identities = 58/65 (89%), Positives = 61/65 (93%) Frame = +1 Query: 1 LAHPLLKASGYGSIVFISSISGLKALPLCSIYAASKGAMNLFTKNVALEWAKDNIRANVV 180 LA+PLLKASGYGSIVFISSISGLKALPLCSIY ASKGAMN TKN+ALEW+KDNIRAN V Sbjct: 137 LAYPLLKASGYGSIVFISSISGLKALPLCSIYGASKGAMNQLTKNLALEWSKDNIRANAV 196 Query: 181 APGPV 195 APGPV Sbjct: 197 APGPV 201 >XP_017416163.1 PREDICTED: tropinone reductase homolog [Vigna angularis] KOM38066.1 hypothetical protein LR48_Vigan03g144800 [Vigna angularis] BAT84504.1 hypothetical protein VIGAN_04190300 [Vigna angularis var. angularis] Length = 266 Score = 117 bits (293), Expect = 2e-29 Identities = 58/65 (89%), Positives = 60/65 (92%) Frame = +1 Query: 1 LAHPLLKASGYGSIVFISSISGLKALPLCSIYAASKGAMNLFTKNVALEWAKDNIRANVV 180 LAHPLLKASGYGSIVFISSI GLKA PLCS+YA+SKGAMN FTKNVALEWAKDNIRAN V Sbjct: 137 LAHPLLKASGYGSIVFISSIGGLKAFPLCSVYASSKGAMNQFTKNVALEWAKDNIRANSV 196 Query: 181 APGPV 195 APG V Sbjct: 197 APGLV 201 >XP_013448955.1 enoyl-(acyl carrier) reductase [Medicago truncatula] KEH22982.1 enoyl-(acyl carrier) reductase [Medicago truncatula] Length = 266 Score = 117 bits (292), Expect = 2e-29 Identities = 58/66 (87%), Positives = 61/66 (92%) Frame = +1 Query: 1 LAHPLLKASGYGSIVFISSISGLKALPLCSIYAASKGAMNLFTKNVALEWAKDNIRANVV 180 LAHPLLK SGYGSIV+ISSISGLKALP S+YAASKGAMN TKN+ALEWAKDNIRANVV Sbjct: 137 LAHPLLKQSGYGSIVYISSISGLKALPFVSVYAASKGAMNQCTKNLALEWAKDNIRANVV 196 Query: 181 APGPVM 198 APGPVM Sbjct: 197 APGPVM 202 >ABO37800.1 oxidoreductase-like protein, partial [Pisum sativum] Length = 177 Score = 114 bits (285), Expect = 3e-29 Identities = 57/65 (87%), Positives = 60/65 (92%) Frame = +1 Query: 1 LAHPLLKASGYGSIVFISSISGLKALPLCSIYAASKGAMNLFTKNVALEWAKDNIRANVV 180 L+HPLLK SGYGSIVFISSI+GLKAL + S YAASKGAMN FTKNVALEWAKDNIRANVV Sbjct: 48 LSHPLLKESGYGSIVFISSIAGLKALDISSAYAASKGAMNQFTKNVALEWAKDNIRANVV 107 Query: 181 APGPV 195 APGPV Sbjct: 108 APGPV 112 >XP_007140487.1 hypothetical protein PHAVU_008G116700g [Phaseolus vulgaris] ESW12481.1 hypothetical protein PHAVU_008G116700g [Phaseolus vulgaris] Length = 143 Score = 113 bits (282), Expect = 3e-29 Identities = 54/66 (81%), Positives = 61/66 (92%) Frame = +1 Query: 1 LAHPLLKASGYGSIVFISSISGLKALPLCSIYAASKGAMNLFTKNVALEWAKDNIRANVV 180 LAHP LK SGYGSIV ISSI+G+KA+P+ S+YAASKGA+N FTKN+ALEWAKDNIRANVV Sbjct: 14 LAHPFLKQSGYGSIVLISSIAGVKAVPVVSVYAASKGALNQFTKNLALEWAKDNIRANVV 73 Query: 181 APGPVM 198 APGPVM Sbjct: 74 APGPVM 79 >XP_014498115.1 PREDICTED: tropinone reductase homolog [Vigna radiata var. radiata] Length = 266 Score = 116 bits (291), Expect = 3e-29 Identities = 58/65 (89%), Positives = 60/65 (92%) Frame = +1 Query: 1 LAHPLLKASGYGSIVFISSISGLKALPLCSIYAASKGAMNLFTKNVALEWAKDNIRANVV 180 LAHPLLKASGYGSIVFISSI GLKA PLCS+YA+SKGAMN FTKNVALEWAKDNIRAN V Sbjct: 137 LAHPLLKASGYGSIVFISSIGGLKASPLCSVYASSKGAMNQFTKNVALEWAKDNIRANSV 196 Query: 181 APGPV 195 APG V Sbjct: 197 APGLV 201 >XP_007140480.1 hypothetical protein PHAVU_008G116200g [Phaseolus vulgaris] XP_007140481.1 hypothetical protein PHAVU_008G116200g [Phaseolus vulgaris] ESW12474.1 hypothetical protein PHAVU_008G116200g [Phaseolus vulgaris] ESW12475.1 hypothetical protein PHAVU_008G116200g [Phaseolus vulgaris] Length = 266 Score = 116 bits (290), Expect = 5e-29 Identities = 56/65 (86%), Positives = 60/65 (92%) Frame = +1 Query: 1 LAHPLLKASGYGSIVFISSISGLKALPLCSIYAASKGAMNLFTKNVALEWAKDNIRANVV 180 LAHPLLKASGYG+IVFISS++GLKA PLCS YAASKGA+N FTKNVALEWAKDNIRAN V Sbjct: 137 LAHPLLKASGYGNIVFISSVAGLKAFPLCSAYAASKGALNQFTKNVALEWAKDNIRANTV 196 Query: 181 APGPV 195 APG V Sbjct: 197 APGAV 201 >XP_007140477.1 hypothetical protein PHAVU_008G115900g [Phaseolus vulgaris] ESW12471.1 hypothetical protein PHAVU_008G115900g [Phaseolus vulgaris] Length = 266 Score = 116 bits (290), Expect = 5e-29 Identities = 56/65 (86%), Positives = 60/65 (92%) Frame = +1 Query: 1 LAHPLLKASGYGSIVFISSISGLKALPLCSIYAASKGAMNLFTKNVALEWAKDNIRANVV 180 LAHPLLKASGYG+IVFISS++GLKA PLCS YAASKGA+N FTKNVALEWAKDNIRAN V Sbjct: 137 LAHPLLKASGYGNIVFISSVAGLKAFPLCSAYAASKGALNQFTKNVALEWAKDNIRANTV 196 Query: 181 APGPV 195 APG V Sbjct: 197 APGAV 201 >GAU37906.1 hypothetical protein TSUD_163430 [Trifolium subterraneum] Length = 266 Score = 115 bits (289), Expect = 7e-29 Identities = 55/66 (83%), Positives = 60/66 (90%) Frame = +1 Query: 1 LAHPLLKASGYGSIVFISSISGLKALPLCSIYAASKGAMNLFTKNVALEWAKDNIRANVV 180 LAHPLLK SGYGS++FISSIS LK LPLCS+YAASKGA+N FTKN+ALEWAKDNIRAN V Sbjct: 137 LAHPLLKQSGYGSVIFISSISSLKTLPLCSVYAASKGAINQFTKNLALEWAKDNIRANAV 196 Query: 181 APGPVM 198 A GPVM Sbjct: 197 AAGPVM 202 >XP_014497093.1 PREDICTED: tropinone reductase homolog [Vigna radiata var. radiata] Length = 266 Score = 115 bits (289), Expect = 7e-29 Identities = 57/65 (87%), Positives = 59/65 (90%) Frame = +1 Query: 1 LAHPLLKASGYGSIVFISSISGLKALPLCSIYAASKGAMNLFTKNVALEWAKDNIRANVV 180 LAHPLLKASGYGSIVFISSI GLKA P CS+YA+SKGAMN FTKNVALEWAKDNIRAN V Sbjct: 137 LAHPLLKASGYGSIVFISSIGGLKAFPFCSVYASSKGAMNQFTKNVALEWAKDNIRANSV 196 Query: 181 APGPV 195 APG V Sbjct: 197 APGLV 201 >XP_007140488.1 hypothetical protein PHAVU_008G116700g [Phaseolus vulgaris] ESW12482.1 hypothetical protein PHAVU_008G116700g [Phaseolus vulgaris] Length = 180 Score = 113 bits (282), Expect = 9e-29 Identities = 54/66 (81%), Positives = 61/66 (92%) Frame = +1 Query: 1 LAHPLLKASGYGSIVFISSISGLKALPLCSIYAASKGAMNLFTKNVALEWAKDNIRANVV 180 LAHP LK SGYGSIV ISSI+G+KA+P+ S+YAASKGA+N FTKN+ALEWAKDNIRANVV Sbjct: 51 LAHPFLKQSGYGSIVLISSIAGVKAVPVVSVYAASKGALNQFTKNLALEWAKDNIRANVV 110 Query: 181 APGPVM 198 APGPVM Sbjct: 111 APGPVM 116 >KHN04072.1 Tropinone reductase like [Glycine soja] Length = 248 Score = 114 bits (286), Expect = 1e-28 Identities = 56/65 (86%), Positives = 60/65 (92%) Frame = +1 Query: 1 LAHPLLKASGYGSIVFISSISGLKALPLCSIYAASKGAMNLFTKNVALEWAKDNIRANVV 180 LAHPLLKASGYGSIVFISSI+GLKALP S+YA+SKGAMN FTKN+ALEWAKDNIRAN V Sbjct: 119 LAHPLLKASGYGSIVFISSIAGLKALPYSSVYASSKGAMNQFTKNIALEWAKDNIRANAV 178 Query: 181 APGPV 195 APG V Sbjct: 179 APGTV 183 >XP_014514897.1 PREDICTED: tropinone reductase homolog [Vigna radiata var. radiata] Length = 265 Score = 115 bits (287), Expect = 1e-28 Identities = 55/65 (84%), Positives = 60/65 (92%) Frame = +1 Query: 1 LAHPLLKASGYGSIVFISSISGLKALPLCSIYAASKGAMNLFTKNVALEWAKDNIRANVV 180 LAHPLLKASGYG+IVFISSI+GLKA PLC+ YAASKGA+N FTKN+ALEWAKDNIRAN V Sbjct: 137 LAHPLLKASGYGNIVFISSIAGLKAFPLCTAYAASKGALNQFTKNIALEWAKDNIRANAV 196 Query: 181 APGPV 195 A GPV Sbjct: 197 ASGPV 201 >NP_001237661.1 uncharacterized protein LOC100306108 [Glycine max] ACU14130.1 unknown [Glycine max] KRH00030.1 hypothetical protein GLYMA_18G186800 [Glycine max] Length = 266 Score = 114 bits (286), Expect = 2e-28 Identities = 56/65 (86%), Positives = 60/65 (92%) Frame = +1 Query: 1 LAHPLLKASGYGSIVFISSISGLKALPLCSIYAASKGAMNLFTKNVALEWAKDNIRANVV 180 LAHPLLKASGYGSIVFISSI+GLKALP S+YA+SKGAMN FTKN+ALEWAKDNIRAN V Sbjct: 137 LAHPLLKASGYGSIVFISSIAGLKALPYSSVYASSKGAMNQFTKNIALEWAKDNIRANAV 196 Query: 181 APGPV 195 APG V Sbjct: 197 APGTV 201