BLASTX nr result
ID: Glycyrrhiza33_contig00020314
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00020314 (323 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_076858678.1 hypothetical protein [Bradyrhizobium sp. SEMIA 6399] 92 2e-20 WP_024582619.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 92 2e-20 SEC48688.1 hypothetical protein SAMN05444164_1959 [Bradyrhizobiu... 91 2e-20 WP_008135017.1 hypothetical protein [Bradyrhizobium sp. YR681] E... 91 2e-20 ERF86108.1 NADPH2:quinone reductase [Bradyrhizobium sp. DFCI-1] 91 3e-20 WP_038385935.1 hypothetical protein [Bradyrhizobium elkanii] 90 7e-20 WP_071912385.1 hypothetical protein [Bradyrhizobium japonicum] A... 90 9e-20 SCB54035.1 hypothetical protein GA0061098_1022116 [Bradyrhizobiu... 90 9e-20 WP_063982362.1 hypothetical protein [Bradyrhizobium sp. G22] CUU... 90 9e-20 WP_063195357.1 hypothetical protein [Bradyrhizobium sp. AT1] KYG... 90 9e-20 WP_044586004.1 hypothetical protein [Bradyrhizobium sp. LTSPM299... 90 9e-20 WP_044541510.1 hypothetical protein [Bradyrhizobium sp. LTSP885]... 90 9e-20 WP_028147500.1 hypothetical protein [Bradyrhizobium japonicum] 90 9e-20 WP_014494129.1 hypothetical protein [Bradyrhizobium japonicum] B... 90 1e-19 WP_015667902.1 hypothetical protein [Bradyrhizobium oligotrophic... 89 2e-19 WP_008974291.1 hypothetical protein [Bradyrhizobium sp. STM 3843... 89 2e-19 WP_009030679.1 hypothetical protein [Bradyrhizobium sp. ORS 375]... 89 2e-19 WP_011925797.1 hypothetical protein [Bradyrhizobium sp. ORS 278]... 89 3e-19 WP_008960449.1 hypothetical protein [Bradyrhizobium sp. STM 3809... 89 3e-19 WP_006614494.1 hypothetical protein [Bradyrhizobium sp. ORS 285]... 89 3e-19 >WP_076858678.1 hypothetical protein [Bradyrhizobium sp. SEMIA 6399] Length = 245 Score = 91.7 bits (226), Expect = 2e-20 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +3 Query: 186 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 323 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE Sbjct: 1 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 46 >WP_024582619.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] KIU47573.1 hypothetical protein QU41_17110 [Bradyrhizobium elkanii] OCX28799.1 hypothetical protein QU42_22425 [Bradyrhizobium sp. UASWS1016] Length = 245 Score = 91.7 bits (226), Expect = 2e-20 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +3 Query: 186 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 323 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE Sbjct: 1 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 46 >SEC48688.1 hypothetical protein SAMN05444164_1959 [Bradyrhizobium erythrophlei] Length = 245 Score = 91.3 bits (225), Expect = 2e-20 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = +3 Query: 186 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 323 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPL+GALAYIVVE Sbjct: 1 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLVGALAYIVVE 46 >WP_008135017.1 hypothetical protein [Bradyrhizobium sp. YR681] EJN13474.1 hypothetical protein PMI42_03170 [Bradyrhizobium sp. YR681] Length = 245 Score = 91.3 bits (225), Expect = 2e-20 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = +3 Query: 186 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 323 MPVALV+LLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE Sbjct: 1 MPVALVVLLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 46 >ERF86108.1 NADPH2:quinone reductase [Bradyrhizobium sp. DFCI-1] Length = 245 Score = 90.9 bits (224), Expect = 3e-20 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = +3 Query: 186 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 323 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGA+AYIVVE Sbjct: 1 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGAIAYIVVE 46 >WP_038385935.1 hypothetical protein [Bradyrhizobium elkanii] Length = 245 Score = 90.1 bits (222), Expect = 7e-20 Identities = 44/46 (95%), Positives = 46/46 (100%) Frame = +3 Query: 186 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 323 MPVALV+LLLDITLIYHA+RTGRLQPWAFIILMVPLIGALAYIVVE Sbjct: 1 MPVALVVLLLDITLIYHAARTGRLQPWAFIILMVPLIGALAYIVVE 46 >WP_071912385.1 hypothetical protein [Bradyrhizobium japonicum] APG10819.1 hypothetical protein BKD09_RS21030 [Bradyrhizobium japonicum] Length = 245 Score = 89.7 bits (221), Expect = 9e-20 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = +3 Query: 186 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 323 MPVALV+LLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYI VE Sbjct: 1 MPVALVVLLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIAVE 46 >SCB54035.1 hypothetical protein GA0061098_1022116 [Bradyrhizobium sp. err11] Length = 245 Score = 89.7 bits (221), Expect = 9e-20 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = +3 Query: 186 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 323 MPVALV+LLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYI VE Sbjct: 1 MPVALVVLLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIAVE 46 >WP_063982362.1 hypothetical protein [Bradyrhizobium sp. G22] CUU17214.1 Tetratricopeptide TPR 2 repeat protein CDS [Bradyrhizobium sp.] Length = 245 Score = 89.7 bits (221), Expect = 9e-20 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = +3 Query: 186 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 323 MPVALV+LLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYI VE Sbjct: 1 MPVALVVLLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIAVE 46 >WP_063195357.1 hypothetical protein [Bradyrhizobium sp. AT1] KYG20364.1 hypothetical protein SE92_08870 [Bradyrhizobium sp. AT1] Length = 245 Score = 89.7 bits (221), Expect = 9e-20 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = +3 Query: 186 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 323 MPVALV+LLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYI VE Sbjct: 1 MPVALVVLLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIAVE 46 >WP_044586004.1 hypothetical protein [Bradyrhizobium sp. LTSPM299] KJC62448.1 hypothetical protein UP10_03790 [Bradyrhizobium sp. LTSPM299] Length = 245 Score = 89.7 bits (221), Expect = 9e-20 Identities = 44/46 (95%), Positives = 46/46 (100%) Frame = +3 Query: 186 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 323 MPVALV+LLLDI+LIYHASRTGRLQPWAFIILMVPLIGALAYIVVE Sbjct: 1 MPVALVVLLLDISLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 46 >WP_044541510.1 hypothetical protein [Bradyrhizobium sp. LTSP885] KJC37044.1 hypothetical protein UP09_27665 [Bradyrhizobium sp. LTSP885] Length = 245 Score = 89.7 bits (221), Expect = 9e-20 Identities = 44/46 (95%), Positives = 46/46 (100%) Frame = +3 Query: 186 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 323 MPVALV+LLLDI+LIYHASRTGRLQPWAFIILMVPLIGALAYIVVE Sbjct: 1 MPVALVVLLLDISLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 46 >WP_028147500.1 hypothetical protein [Bradyrhizobium japonicum] Length = 245 Score = 89.7 bits (221), Expect = 9e-20 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = +3 Query: 186 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 323 MPVALV+LLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYI VE Sbjct: 1 MPVALVVLLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIAVE 46 >WP_014494129.1 hypothetical protein [Bradyrhizobium japonicum] BAL09278.1 hypothetical protein BJ6T_40040 [Bradyrhizobium japonicum USDA 6] AJA62260.1 hypothetical protein RN69_19435 [Bradyrhizobium japonicum] KMJ96549.1 hypothetical protein CF64_24305 [Bradyrhizobium japonicum] Length = 247 Score = 89.7 bits (221), Expect = 1e-19 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = +3 Query: 186 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 323 MPVALV+LLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYI VE Sbjct: 1 MPVALVVLLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIAVE 46 >WP_015667902.1 hypothetical protein [Bradyrhizobium oligotrophicum] BAM90812.1 conserved hypothetical protein [Bradyrhizobium oligotrophicum S58] Length = 245 Score = 89.0 bits (219), Expect = 2e-19 Identities = 43/46 (93%), Positives = 46/46 (100%) Frame = +3 Query: 186 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 323 MPVALV+LLLDI+LIYHASRTGRLQPWAFIILMVP+IGALAYIVVE Sbjct: 1 MPVALVVLLLDISLIYHASRTGRLQPWAFIILMVPMIGALAYIVVE 46 >WP_008974291.1 hypothetical protein [Bradyrhizobium sp. STM 3843] CCE11784.1 conserved hypothetical protein [Bradyrhizobium sp. STM 3843] Length = 245 Score = 89.0 bits (219), Expect = 2e-19 Identities = 43/46 (93%), Positives = 46/46 (100%) Frame = +3 Query: 186 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 323 MPVALV+LLLDITLIYHA+RTGRLQPWAFIILMVPLIG+LAYIVVE Sbjct: 1 MPVALVVLLLDITLIYHAARTGRLQPWAFIILMVPLIGSLAYIVVE 46 >WP_009030679.1 hypothetical protein [Bradyrhizobium sp. ORS 375] CCD95772.1 conserved hypothetical protein [Bradyrhizobium sp. ORS 375] Length = 245 Score = 89.0 bits (219), Expect = 2e-19 Identities = 43/46 (93%), Positives = 46/46 (100%) Frame = +3 Query: 186 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 323 MPVALV+LLLDI+LIYHASRTGRLQPWAFIILMVP+IGALAYIVVE Sbjct: 1 MPVALVVLLLDISLIYHASRTGRLQPWAFIILMVPMIGALAYIVVE 46 >WP_011925797.1 hypothetical protein [Bradyrhizobium sp. ORS 278] CAL76593.1 conserved hypothetical protein; Putative TPR domain protein [Bradyrhizobium sp. ORS 278] Length = 245 Score = 88.6 bits (218), Expect = 3e-19 Identities = 42/46 (91%), Positives = 46/46 (100%) Frame = +3 Query: 186 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 323 MP+ALV+LLLDI+LIYHASRTGRLQPWAFIILMVP+IGALAYIVVE Sbjct: 1 MPIALVVLLLDISLIYHASRTGRLQPWAFIILMVPMIGALAYIVVE 46 >WP_008960449.1 hypothetical protein [Bradyrhizobium sp. STM 3809] CCD97834.1 conserved hypothetical protein [Bradyrhizobium sp. STM 3809] Length = 245 Score = 88.6 bits (218), Expect = 3e-19 Identities = 42/46 (91%), Positives = 46/46 (100%) Frame = +3 Query: 186 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 323 MP+ALV+LLLDI+LIYHASRTGRLQPWAFIILMVP+IGALAYIVVE Sbjct: 1 MPIALVVLLLDISLIYHASRTGRLQPWAFIILMVPMIGALAYIVVE 46 >WP_006614494.1 hypothetical protein [Bradyrhizobium sp. ORS 285] CCD89153.1 conserved hypothetical protein [Bradyrhizobium sp. ORS 285] Length = 245 Score = 88.6 bits (218), Expect = 3e-19 Identities = 42/46 (91%), Positives = 46/46 (100%) Frame = +3 Query: 186 MPVALVILLLDITLIYHASRTGRLQPWAFIILMVPLIGALAYIVVE 323 MP+ALV+LLLDI+LIYHASRTGRLQPWAFIILMVP+IGALAYIVVE Sbjct: 1 MPIALVVLLLDISLIYHASRTGRLQPWAFIILMVPMIGALAYIVVE 46