BLASTX nr result
ID: Glycyrrhiza33_contig00020272
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00020272 (427 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016169925.1 PREDICTED: uncharacterized protein LOC107612724 [... 54 8e-06 XP_015937909.1 PREDICTED: uncharacterized protein LOC107463599 [... 54 8e-06 >XP_016169925.1 PREDICTED: uncharacterized protein LOC107612724 [Arachis ipaensis] Length = 627 Score = 54.3 bits (129), Expect = 8e-06 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 9/41 (21%) Frame = -2 Query: 96 MGLPQVSSGCLAEEVAAS---------RIASISNYELNLLA 1 MGLPQVSSGC+AEEVAAS RIASISNYELN+LA Sbjct: 1 MGLPQVSSGCIAEEVAASLGTFVQTAPRIASISNYELNMLA 41 >XP_015937909.1 PREDICTED: uncharacterized protein LOC107463599 [Arachis duranensis] Length = 627 Score = 54.3 bits (129), Expect = 8e-06 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 9/41 (21%) Frame = -2 Query: 96 MGLPQVSSGCLAEEVAAS---------RIASISNYELNLLA 1 MGLPQVSSGC+AEEVAAS RIASISNYELN+LA Sbjct: 1 MGLPQVSSGCIAEEVAASLGTFVQTAPRIASISNYELNMLA 41