BLASTX nr result
ID: Glycyrrhiza33_contig00020095
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00020095 (336 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003533992.1 PREDICTED: SKP1-like protein 21 isoform X2 [Glyci... 59 5e-08 KRH38436.1 hypothetical protein GLYMA_09G136000 [Glycine max] 59 5e-08 XP_006587291.1 PREDICTED: SKP1-like protein 21 isoform X1 [Glyci... 59 5e-08 KRH38434.1 hypothetical protein GLYMA_09G136000 [Glycine max] 59 5e-08 KHN12502.1 SKP1-like protein 21 [Glycine soja] 53 6e-07 KHN41465.1 SKP1-like protein 21 [Glycine soja] 54 4e-06 AFK41388.1 unknown [Medicago truncatula] 49 8e-06 >XP_003533992.1 PREDICTED: SKP1-like protein 21 isoform X2 [Glycine max] KRH38437.1 hypothetical protein GLYMA_09G136000 [Glycine max] Length = 344 Score = 59.3 bits (142), Expect = 5e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 334 RMQILSLGQDRRLVPISMNSNGSTRLCTSFDRR 236 RMQILSLGQDRRLVPISMNSNGST L T FD+R Sbjct: 312 RMQILSLGQDRRLVPISMNSNGSTHLYTGFDQR 344 >KRH38436.1 hypothetical protein GLYMA_09G136000 [Glycine max] Length = 348 Score = 59.3 bits (142), Expect = 5e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 334 RMQILSLGQDRRLVPISMNSNGSTRLCTSFDRR 236 RMQILSLGQDRRLVPISMNSNGST L T FD+R Sbjct: 316 RMQILSLGQDRRLVPISMNSNGSTHLYTGFDQR 348 >XP_006587291.1 PREDICTED: SKP1-like protein 21 isoform X1 [Glycine max] XP_014617618.1 PREDICTED: SKP1-like protein 21 isoform X1 [Glycine max] KRH38435.1 hypothetical protein GLYMA_09G136000 [Glycine max] Length = 356 Score = 59.3 bits (142), Expect = 5e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 334 RMQILSLGQDRRLVPISMNSNGSTRLCTSFDRR 236 RMQILSLGQDRRLVPISMNSNGST L T FD+R Sbjct: 324 RMQILSLGQDRRLVPISMNSNGSTHLYTGFDQR 356 >KRH38434.1 hypothetical protein GLYMA_09G136000 [Glycine max] Length = 360 Score = 59.3 bits (142), Expect = 5e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 334 RMQILSLGQDRRLVPISMNSNGSTRLCTSFDRR 236 RMQILSLGQDRRLVPISMNSNGST L T FD+R Sbjct: 328 RMQILSLGQDRRLVPISMNSNGSTHLYTGFDQR 360 >KHN12502.1 SKP1-like protein 21 [Glycine soja] Length = 75 Score = 52.8 bits (125), Expect = 6e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 334 RMQILSLGQDRRLVPISMNSNGSTRLCT 251 RMQILSLGQDRRLVPISMNSNGST+L T Sbjct: 19 RMQILSLGQDRRLVPISMNSNGSTQLYT 46 >KHN41465.1 SKP1-like protein 21 [Glycine soja] Length = 357 Score = 53.9 bits (128), Expect = 4e-06 Identities = 31/45 (68%), Positives = 32/45 (71%) Frame = -3 Query: 334 RMQILSLGQDRRLVPISMNSNGSTRLCTSFDRR*CKPTPADNSIS 200 RMQILSLGQDRRLVPISMNSNGST L T+ ADN IS Sbjct: 315 RMQILSLGQDRRLVPISMNSNGSTHLYTAL---------ADNPIS 350 >AFK41388.1 unknown [Medicago truncatula] Length = 55 Score = 49.3 bits (116), Expect = 8e-06 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -3 Query: 334 RMQILSLGQDRRLVPISMNSNGSTRLCTSFDRR 236 R+QIL Q+RRL PISMNSNGST CTSF RR Sbjct: 23 RIQILPSHQNRRLTPISMNSNGSTNRCTSFGRR 55