BLASTX nr result
ID: Glycyrrhiza33_contig00019794
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00019794 (408 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP42564.1 Retrovirus-related Pol polyprotein from transposon TN... 51 4e-10 KYP39615.1 Retrovirus-related Pol polyprotein from transposon TN... 49 1e-09 KYP65704.1 Retrovirus-related Pol polyprotein from transposon TN... 50 4e-09 KYP44715.1 Retrovirus-related Pol polyprotein from transposon TN... 45 4e-08 KYP76882.1 Retrovirus-related Pol polyprotein from transposon TN... 47 5e-08 XP_014515464.1 PREDICTED: uncharacterized protein LOC106773270 [... 45 3e-06 >KYP42564.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1427 Score = 50.8 bits (120), Expect(2) = 4e-10 Identities = 23/62 (37%), Positives = 37/62 (59%) Frame = +1 Query: 157 AKLHHNRYILSQFPNNSACTETNDNTLVLTARNSNFDNIDVWHYRLGHPSHNVLQTVCTS 336 A++ ++ YIL + +++ + N+++ + D+WHYRLGHPSH VLQTV Sbjct: 450 AEVKNHLYILQRPSKDNSISACKSNSVLNAQPKGTTSSFDLWHYRLGHPSHVVLQTVKRL 509 Query: 337 FP 342 FP Sbjct: 510 FP 511 Score = 40.4 bits (93), Expect(2) = 4e-10 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = +2 Query: 341 HVTFNKNFICDCCHFSKQSRLP 406 +VT+NKN CD CHF KQ+RLP Sbjct: 512 YVTYNKNITCDYCHFGKQARLP 533 >KYP39615.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1239 Score = 49.3 bits (116), Expect(2) = 1e-09 Identities = 25/64 (39%), Positives = 37/64 (57%) Frame = +1 Query: 151 AHAKLHHNRYILSQFPNNSACTETNDNTLVLTARNSNFDNIDVWHYRLGHPSHNVLQTVC 330 A K H N IL + +++ + N+++ + + D+WHYRLGHPSH VLQTV Sbjct: 365 AEVKNHLN--ILQRPSKDNSISACKSNSVLNAQPKATTSSFDLWHYRLGHPSHVVLQTVK 422 Query: 331 TSFP 342 +FP Sbjct: 423 RNFP 426 Score = 40.4 bits (93), Expect(2) = 1e-09 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = +2 Query: 341 HVTFNKNFICDCCHFSKQSRLP 406 +VT+NKN CD CHF KQ+RLP Sbjct: 427 YVTYNKNITCDYCHFGKQARLP 448 >KYP65704.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 603 Score = 50.1 bits (118), Expect(2) = 4e-09 Identities = 22/62 (35%), Positives = 38/62 (61%) Frame = +1 Query: 157 AKLHHNRYILSQFPNNSACTETNDNTLVLTARNSNFDNIDVWHYRLGHPSHNVLQTVCTS 336 A++ ++ YIL + +++ + N+++ + + D+WHYRLGHPSH VLQ V + Sbjct: 381 AEVKNHLYILQRPSKDNSISACKSNSVLNAQLKATTSSFDLWHYRLGHPSHVVLQIVKSH 440 Query: 337 FP 342 FP Sbjct: 441 FP 442 Score = 38.1 bits (87), Expect(2) = 4e-09 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = +2 Query: 341 HVTFNKNFICDCCHFSKQSRLP 406 +VT+NKN CD C+F KQ+RLP Sbjct: 443 YVTYNKNITCDYCYFGKQARLP 464 >KYP44715.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] KYP44722.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 137 Score = 44.7 bits (104), Expect(2) = 4e-08 Identities = 21/62 (33%), Positives = 35/62 (56%) Frame = +1 Query: 157 AKLHHNRYILSQFPNNSACTETNDNTLVLTARNSNFDNIDVWHYRLGHPSHNVLQTVCTS 336 A++ ++ YIL +++ + N+++ + + D+ HYRLGHPSH VL TV Sbjct: 5 AEVKNHLYILQHSSKDNSISACKSNSVLNAQPKATTSSFDLCHYRLGHPSHVVLHTVERH 64 Query: 337 FP 342 FP Sbjct: 65 FP 66 Score = 40.0 bits (92), Expect(2) = 4e-08 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = +2 Query: 341 HVTFNKNFICDCCHFSKQSRLP 406 +VT+NKN CD CHF KQ+RLP Sbjct: 67 YVTYNKNVTCDYCHFGKQARLP 88 >KYP76882.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 187 Score = 47.4 bits (111), Expect(2) = 5e-08 Identities = 21/55 (38%), Positives = 31/55 (56%) Frame = +1 Query: 178 YILSQFPNNSACTETNDNTLVLTARNSNFDNIDVWHYRLGHPSHNVLQTVCTSFP 342 YIL ++ + N+++ + + D+WHYRLGHPSH VLQT+ FP Sbjct: 12 YILQPSSKDNFVSACKSNSVLNAQPKATTSSFDLWHYRLGHPSHVVLQTMKIHFP 66 Score = 37.0 bits (84), Expect(2) = 5e-08 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = +2 Query: 341 HVTFNKNFICDCCHFSKQSRLP 406 +VT+NKN CD CHF KQ+ LP Sbjct: 67 YVTYNKNVTCDYCHFGKQTILP 88 >XP_014515464.1 PREDICTED: uncharacterized protein LOC106773270 [Vigna radiata var. radiata] Length = 1085 Score = 45.4 bits (106), Expect(2) = 3e-06 Identities = 25/64 (39%), Positives = 34/64 (53%), Gaps = 2/64 (3%) Frame = +1 Query: 157 AKLHHNRYILSQFPNNSACTETNDNTLVLTARNSNFDNIDV--WHYRLGHPSHNVLQTVC 330 A H Y L FP T D V + + +F ++DV WHYRLGHP +NV++ +C Sbjct: 447 ANPHKGLYYLQAFP-------TADQDFV-SKTDFSFKHLDVNLWHYRLGHPGYNVVKQIC 498 Query: 331 TSFP 342 FP Sbjct: 499 DHFP 502 Score = 32.7 bits (73), Expect(2) = 3e-06 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +2 Query: 341 HVTFNKNFICDCCHFSKQSRLP 406 +V N N +CD CH++KQ +LP Sbjct: 503 YVQANTNVVCDVCHYAKQHKLP 524