BLASTX nr result
ID: Glycyrrhiza33_contig00019580
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00019580 (336 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAC32125.1 actin, partial [Picea mariana] 96 3e-24 WP_071414478.1 hypothetical protein [Acinetobacter baumannii] OI... 96 4e-24 JAU90273.1 Actin, partial [Noccaea caerulescens] 96 5e-24 JAU26149.1 Actin, partial [Noccaea caerulescens] 96 7e-24 JAU98109.1 Actin [Noccaea caerulescens] 96 8e-24 BAB60900.1 actin, partial [Ipomoea nil] 96 9e-24 CAA10126.1 actin, partial [Cicer arietinum] 96 1e-23 AFK39692.1 unknown [Medicago truncatula] 96 1e-23 JAU24264.1 Actin-3, partial [Noccaea caerulescens] 96 1e-23 AAC60565.1 actin, partial [Striga asiatica] 96 1e-23 AHA91825.1 actin-1, partial [Rosa hybrid cultivar] 95 2e-23 AEG78680.1 actin, partial [Erythroxylum coca] 94 3e-23 AML60265.1 actin 4, partial [Morus alba] 94 3e-23 KDO53390.1 hypothetical protein CISIN_1g040984mg [Citrus sinensis] 94 3e-23 XP_013073050.1 PREDICTED: actin, alpha skeletal muscle [Biomphal... 95 3e-23 AAT37544.1 actin 1.6, partial [Hydra vulgaris] AAT37545.1 actin ... 93 4e-23 AAW83504.1 actin, partial [Ipomoea batatas] 94 4e-23 KHN84516.1 Actin-1 [Toxocara canis] KIH65223.1 hypothetical prot... 93 4e-23 AAX92681.1 actin, partial [Picea abies] 96 4e-23 CAB61444.1 unnamed protein product, partial [Drosophila melanoga... 93 4e-23 >AAC32125.1 actin, partial [Picea mariana] Length = 53 Score = 96.3 bits (238), Expect = 3e-24 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -1 Query: 336 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 205 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 10 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 53 >WP_071414478.1 hypothetical protein [Acinetobacter baumannii] OIC63224.1 hypothetical protein A7L55_18690 [Acinetobacter baumannii] Length = 71 Score = 96.3 bits (238), Expect = 4e-24 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -1 Query: 336 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 205 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 28 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 71 >JAU90273.1 Actin, partial [Noccaea caerulescens] Length = 79 Score = 96.3 bits (238), Expect = 5e-24 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -1 Query: 336 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 205 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 36 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 79 >JAU26149.1 Actin, partial [Noccaea caerulescens] Length = 90 Score = 96.3 bits (238), Expect = 7e-24 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -1 Query: 336 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 205 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 47 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 90 >JAU98109.1 Actin [Noccaea caerulescens] Length = 93 Score = 96.3 bits (238), Expect = 8e-24 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -1 Query: 336 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 205 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 50 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 93 >BAB60900.1 actin, partial [Ipomoea nil] Length = 100 Score = 96.3 bits (238), Expect = 9e-24 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -1 Query: 336 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 205 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 57 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 100 >CAA10126.1 actin, partial [Cicer arietinum] Length = 103 Score = 96.3 bits (238), Expect = 1e-23 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -1 Query: 336 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 205 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 60 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 103 >AFK39692.1 unknown [Medicago truncatula] Length = 110 Score = 96.3 bits (238), Expect = 1e-23 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -1 Query: 336 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 205 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 67 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 110 >JAU24264.1 Actin-3, partial [Noccaea caerulescens] Length = 113 Score = 96.3 bits (238), Expect = 1e-23 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -1 Query: 336 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 205 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 70 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 113 >AAC60565.1 actin, partial [Striga asiatica] Length = 114 Score = 96.3 bits (238), Expect = 1e-23 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -1 Query: 336 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 205 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 71 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 114 >AHA91825.1 actin-1, partial [Rosa hybrid cultivar] Length = 84 Score = 95.1 bits (235), Expect = 2e-23 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 336 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 205 PPERKYSVWIGGSILASLSTFQQMWI+KAEYDESGPSIVHRKCF Sbjct: 41 PPERKYSVWIGGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 84 >AEG78680.1 actin, partial [Erythroxylum coca] Length = 45 Score = 93.6 bits (231), Expect = 3e-23 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -1 Query: 336 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 205 PPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 2 PPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 45 >AML60265.1 actin 4, partial [Morus alba] Length = 47 Score = 93.6 bits (231), Expect = 3e-23 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -1 Query: 336 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 205 PPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 4 PPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 47 >KDO53390.1 hypothetical protein CISIN_1g040984mg [Citrus sinensis] Length = 51 Score = 93.6 bits (231), Expect = 3e-23 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -1 Query: 336 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 205 PPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 8 PPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 51 >XP_013073050.1 PREDICTED: actin, alpha skeletal muscle [Biomphalaria glabrata] Length = 107 Score = 95.1 bits (235), Expect = 3e-23 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 336 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 205 PPERKYSVWIGGSILASLSTFQQMWI+KAEYDESGPSIVHRKCF Sbjct: 64 PPERKYSVWIGGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 107 >AAT37544.1 actin 1.6, partial [Hydra vulgaris] AAT37545.1 actin 1.7, partial [Hydra vulgaris] Length = 45 Score = 93.2 bits (230), Expect = 4e-23 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -1 Query: 336 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 205 PPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 2 PPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 45 >AAW83504.1 actin, partial [Ipomoea batatas] Length = 77 Score = 94.0 bits (232), Expect = 4e-23 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = -1 Query: 336 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 205 PPERKYSVWIGGSILASLST QQMWIAKAEYDESGPSIVHRKCF Sbjct: 34 PPERKYSVWIGGSILASLSTLQQMWIAKAEYDESGPSIVHRKCF 77 >KHN84516.1 Actin-1 [Toxocara canis] KIH65223.1 hypothetical protein ANCDUO_04453 [Ancylostoma duodenale] Length = 51 Score = 93.2 bits (230), Expect = 4e-23 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -1 Query: 336 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 205 PPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 8 PPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 51 >AAX92681.1 actin, partial [Picea abies] Length = 155 Score = 96.3 bits (238), Expect = 4e-23 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = -1 Query: 336 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 205 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 112 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 155 >CAB61444.1 unnamed protein product, partial [Drosophila melanogaster] Length = 53 Score = 93.2 bits (230), Expect = 4e-23 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -1 Query: 336 PPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 205 PPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 10 PPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 53