BLASTX nr result
ID: Glycyrrhiza33_contig00019321
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00019321 (329 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003550271.1 PREDICTED: uncharacterized protein LOC100778066 [... 57 3e-07 XP_004498897.1 PREDICTED: DNA topoisomerase 1-like [Cicer arieti... 57 4e-07 GAU23484.1 hypothetical protein TSUD_81660 [Trifolium subterraneum] 55 1e-06 XP_004513690.1 PREDICTED: WD repeat-containing protein 87-like [... 53 8e-06 >XP_003550271.1 PREDICTED: uncharacterized protein LOC100778066 [Glycine max] XP_006601233.1 PREDICTED: uncharacterized protein LOC100778066 [Glycine max] XP_006601234.1 PREDICTED: uncharacterized protein LOC100778066 [Glycine max] XP_006601235.1 PREDICTED: uncharacterized protein LOC100778066 [Glycine max] KHN37031.1 hypothetical protein glysoja_009059 [Glycine soja] KRH05461.1 hypothetical protein GLYMA_17G228900 [Glycine max] KRH05462.1 hypothetical protein GLYMA_17G228900 [Glycine max] KRH05463.1 hypothetical protein GLYMA_17G228900 [Glycine max] KRH05464.1 hypothetical protein GLYMA_17G228900 [Glycine max] Length = 315 Score = 57.0 bits (136), Expect = 3e-07 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -2 Query: 328 EEVKMEQRKKRKKEDMEGRPEDRSGDLTKKRMKRKHEGD 212 EEVK+EQ K R+ +D EGRPED +GDL+KK+ K+ H GD Sbjct: 276 EEVKLEQSKNRRSDDAEGRPEDPTGDLSKKKRKKTHNGD 314 >XP_004498897.1 PREDICTED: DNA topoisomerase 1-like [Cicer arietinum] Length = 315 Score = 56.6 bits (135), Expect = 4e-07 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -2 Query: 328 EEVKMEQRKKRKKEDMEGRPEDRSGDLTKKRMKRKHEG 215 EEVK +Q+KK+ +++E R EDRSG+L+KKRMKRKHEG Sbjct: 276 EEVKTDQKKKKMNKNVEERSEDRSGELSKKRMKRKHEG 313 >GAU23484.1 hypothetical protein TSUD_81660 [Trifolium subterraneum] Length = 326 Score = 55.5 bits (132), Expect = 1e-06 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -2 Query: 328 EEVKMEQRKKRKKEDMEGRPEDRSGDLTKKRMKRKHEG 215 EEV E+RKKRK +D+E + E+RSG+ +KK+MKRKHEG Sbjct: 289 EEVSTEKRKKRKNQDLEEKSEERSGERSKKKMKRKHEG 326 >XP_004513690.1 PREDICTED: WD repeat-containing protein 87-like [Cicer arietinum] Length = 274 Score = 52.8 bits (125), Expect = 8e-06 Identities = 27/40 (67%), Positives = 32/40 (80%), Gaps = 3/40 (7%) Frame = -2 Query: 328 EEVKMEQRKKRKKEDMEG---RPEDRSGDLTKKRMKRKHE 218 EEVKMEQ+KK+KK+ EG R EDRSG+ +KKRMK KHE Sbjct: 232 EEVKMEQKKKKKKKKNEGVEERSEDRSGEHSKKRMKMKHE 271