BLASTX nr result
ID: Glycyrrhiza33_contig00019287
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00019287 (506 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH26147.1 hypothetical protein GLYMA_12G155000 [Glycine max] 71 6e-13 >KRH26147.1 hypothetical protein GLYMA_12G155000 [Glycine max] Length = 121 Score = 71.2 bits (173), Expect = 6e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +2 Query: 401 DPEDRTLAFLHRLGLALMMGRLVVLLPPYLIRGLS 505 DPEDRTLAFLHRLGLALMMGRLVVLLPPYLI+GLS Sbjct: 62 DPEDRTLAFLHRLGLALMMGRLVVLLPPYLIKGLS 96