BLASTX nr result
ID: Glycyrrhiza33_contig00018960
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00018960 (367 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003519251.2 PREDICTED: elongator complex protein 5-like [Glyc... 76 8e-14 XP_006595561.1 PREDICTED: uncharacterized protein LOC100792556 i... 75 1e-13 XP_014503490.1 PREDICTED: elongator complex protein 5 [Vigna rad... 75 1e-13 XP_017428325.1 PREDICTED: elongator complex protein 5 [Vigna ang... 75 1e-13 KRH17035.1 hypothetical protein GLYMA_14G193600 [Glycine max] 75 1e-13 KHN40070.1 hypothetical protein glysoja_009447 [Glycine soja] 75 1e-13 XP_007142209.1 hypothetical protein PHAVU_008G261300g [Phaseolus... 75 1e-13 NP_001242822.1 dermal papilla-derived protein 6 homolog [Glycine... 75 1e-13 XP_003615675.1 elongator complex protein [Medicago truncatula] A... 73 1e-12 KYP52290.1 Dermal papilla-derived protein 6 isogeny [Cajanus cajan] 73 1e-12 XP_016181799.1 PREDICTED: elongator complex protein 5 [Arachis i... 72 2e-12 KHG23543.1 ATP-dependent protease ATPase subunit HslU [Gossypium... 71 3e-12 XP_017638347.1 PREDICTED: elongator complex protein 5 isoform X2... 71 4e-12 XP_016723905.1 PREDICTED: elongator complex protein 5 isoform X2... 71 4e-12 XP_004490597.1 PREDICTED: elongator complex protein 5 isoform X1... 71 4e-12 XP_012468585.1 PREDICTED: elongator complex protein 5-like [Goss... 67 4e-12 XP_017638346.1 PREDICTED: elongator complex protein 5 isoform X1... 71 4e-12 XP_016723879.1 PREDICTED: elongator complex protein 5 isoform X1... 71 4e-12 XP_015946172.1 PREDICTED: elongator complex protein 5 [Arachis d... 71 6e-12 XP_010108851.1 hypothetical protein L484_027044 [Morus notabilis... 70 1e-11 >XP_003519251.2 PREDICTED: elongator complex protein 5-like [Glycine max] KHN46154.1 Dermal papilla-derived protein 6 like [Glycine soja] KRH72675.1 hypothetical protein GLYMA_02G226700 [Glycine max] Length = 418 Score = 76.3 bits (186), Expect = 8e-14 Identities = 38/48 (79%), Positives = 40/48 (83%) Frame = +1 Query: 223 LVPDRAQEMAESICRYLRDGALEGELAPTLTIKDSLASPFAFDVFSHI 366 L P +MA+SICR LRDGALEGEL PTLTIKDSLASPFAF VFSHI Sbjct: 38 LFPATQPKMADSICRTLRDGALEGELVPTLTIKDSLASPFAFHVFSHI 85 >XP_006595561.1 PREDICTED: uncharacterized protein LOC100792556 isoform X1 [Glycine max] Length = 357 Score = 75.5 bits (184), Expect = 1e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +1 Query: 247 MAESICRYLRDGALEGELAPTLTIKDSLASPFAFDVFSHI 366 MA+SICR LRDGALEGELAPTLTIKDSLASPFAF VFSHI Sbjct: 1 MADSICRTLRDGALEGELAPTLTIKDSLASPFAFHVFSHI 40 >XP_014503490.1 PREDICTED: elongator complex protein 5 [Vigna radiata var. radiata] Length = 371 Score = 75.5 bits (184), Expect = 1e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +1 Query: 247 MAESICRYLRDGALEGELAPTLTIKDSLASPFAFDVFSHI 366 MA+SICR LRDGALEGELAPTLTIKDSLASPFAF VFSHI Sbjct: 1 MADSICRTLRDGALEGELAPTLTIKDSLASPFAFHVFSHI 40 >XP_017428325.1 PREDICTED: elongator complex protein 5 [Vigna angularis] XP_017428326.1 PREDICTED: elongator complex protein 5 [Vigna angularis] KOM47461.1 hypothetical protein LR48_Vigan07g116500 [Vigna angularis] BAT81541.1 hypothetical protein VIGAN_03128500 [Vigna angularis var. angularis] Length = 371 Score = 75.5 bits (184), Expect = 1e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +1 Query: 247 MAESICRYLRDGALEGELAPTLTIKDSLASPFAFDVFSHI 366 MA+SICR LRDGALEGELAPTLTIKDSLASPFAF VFSHI Sbjct: 1 MADSICRTLRDGALEGELAPTLTIKDSLASPFAFHVFSHI 40 >KRH17035.1 hypothetical protein GLYMA_14G193600 [Glycine max] Length = 372 Score = 75.5 bits (184), Expect = 1e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +1 Query: 247 MAESICRYLRDGALEGELAPTLTIKDSLASPFAFDVFSHI 366 MA+SICR LRDGALEGELAPTLTIKDSLASPFAF VFSHI Sbjct: 1 MADSICRTLRDGALEGELAPTLTIKDSLASPFAFHVFSHI 40 >KHN40070.1 hypothetical protein glysoja_009447 [Glycine soja] Length = 372 Score = 75.5 bits (184), Expect = 1e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +1 Query: 247 MAESICRYLRDGALEGELAPTLTIKDSLASPFAFDVFSHI 366 MA+SICR LRDGALEGELAPTLTIKDSLASPFAF VFSHI Sbjct: 1 MADSICRTLRDGALEGELAPTLTIKDSLASPFAFHVFSHI 40 >XP_007142209.1 hypothetical protein PHAVU_008G261300g [Phaseolus vulgaris] ESW14203.1 hypothetical protein PHAVU_008G261300g [Phaseolus vulgaris] Length = 372 Score = 75.5 bits (184), Expect = 1e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +1 Query: 247 MAESICRYLRDGALEGELAPTLTIKDSLASPFAFDVFSHI 366 MA+SICR LRDGALEGELAPTLTIKDSLASPFAF VFSHI Sbjct: 1 MADSICRTLRDGALEGELAPTLTIKDSLASPFAFHVFSHI 40 >NP_001242822.1 dermal papilla-derived protein 6 homolog [Glycine max] ACU18222.1 unknown [Glycine max] Length = 372 Score = 75.5 bits (184), Expect = 1e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +1 Query: 247 MAESICRYLRDGALEGELAPTLTIKDSLASPFAFDVFSHI 366 MA+SICR LRDGALEGELAPTLTIKDSLASPFAF VFSHI Sbjct: 1 MADSICRTLRDGALEGELAPTLTIKDSLASPFAFHVFSHI 40 >XP_003615675.1 elongator complex protein [Medicago truncatula] AES98633.1 elongator complex protein [Medicago truncatula] Length = 362 Score = 72.8 bits (177), Expect = 1e-12 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +1 Query: 247 MAESICRYLRDGALEGELAPTLTIKDSLASPFAFDVFSHI 366 M+ESICR LRDGALEGEL+PTLTIKD+L+SPFAF+VFSHI Sbjct: 1 MSESICRSLRDGALEGELSPTLTIKDTLSSPFAFNVFSHI 40 >KYP52290.1 Dermal papilla-derived protein 6 isogeny [Cajanus cajan] Length = 372 Score = 72.8 bits (177), Expect = 1e-12 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +1 Query: 247 MAESICRYLRDGALEGELAPTLTIKDSLASPFAFDVFSHI 366 MA+SICR LRDGALEGELAPTLTIKDSLASPF F +FSHI Sbjct: 1 MADSICRTLRDGALEGELAPTLTIKDSLASPFGFHLFSHI 40 >XP_016181799.1 PREDICTED: elongator complex protein 5 [Arachis ipaensis] XP_016181800.1 PREDICTED: elongator complex protein 5 [Arachis ipaensis] Length = 368 Score = 72.4 bits (176), Expect = 2e-12 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +1 Query: 247 MAESICRYLRDGALEGELAPTLTIKDSLASPFAFDVFSHI 366 MAES+CR LRDGALEGELAP LTIKDSL+SPF F+VFSHI Sbjct: 1 MAESVCRSLRDGALEGELAPALTIKDSLSSPFGFNVFSHI 40 >KHG23543.1 ATP-dependent protease ATPase subunit HslU [Gossypium arboreum] Length = 312 Score = 71.2 bits (173), Expect = 3e-12 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +1 Query: 247 MAESICRYLRDGALEGELAPTLTIKDSLASPFAFDVFSHI 366 MAESICR LRDGALEGELAP LTIKDS+ASPFA VFSH+ Sbjct: 1 MAESICRALRDGALEGELAPALTIKDSVASPFALQVFSHV 40 >XP_017638347.1 PREDICTED: elongator complex protein 5 isoform X2 [Gossypium arboreum] Length = 359 Score = 71.2 bits (173), Expect = 4e-12 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +1 Query: 247 MAESICRYLRDGALEGELAPTLTIKDSLASPFAFDVFSHI 366 MAESICR LRDGALEGELAP LTIKDS+ASPFA VFSH+ Sbjct: 1 MAESICRALRDGALEGELAPALTIKDSVASPFALQVFSHV 40 >XP_016723905.1 PREDICTED: elongator complex protein 5 isoform X2 [Gossypium hirsutum] XP_016723912.1 PREDICTED: elongator complex protein 5 isoform X2 [Gossypium hirsutum] Length = 359 Score = 71.2 bits (173), Expect = 4e-12 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +1 Query: 247 MAESICRYLRDGALEGELAPTLTIKDSLASPFAFDVFSHI 366 MAESICR LRDGALEGELAP LTIKDS+ASPFA VFSH+ Sbjct: 1 MAESICRALRDGALEGELAPALTIKDSVASPFALQVFSHV 40 >XP_004490597.1 PREDICTED: elongator complex protein 5 isoform X1 [Cicer arietinum] XP_004490598.1 PREDICTED: elongator complex protein 5 isoform X2 [Cicer arietinum] Length = 365 Score = 71.2 bits (173), Expect = 4e-12 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +1 Query: 247 MAESICRYLRDGALEGELAPTLTIKDSLASPFAFDVFSHI 366 MAESI R LRDGALEGELAPTLTIKDSL+SPFAF VFSHI Sbjct: 1 MAESIFRTLRDGALEGELAPTLTIKDSLSSPFAFHVFSHI 40 >XP_012468585.1 PREDICTED: elongator complex protein 5-like [Gossypium raimondii] Length = 87 Score = 66.6 bits (161), Expect = 4e-12 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +1 Query: 247 MAESICRYLRDGALEGELAPTLTIKDSLASPFAFDVFSHI 366 MAESICR LRDGALEGELAP TI+DS+ SPFA VFSH+ Sbjct: 1 MAESICRALRDGALEGELAPAFTIEDSVTSPFALQVFSHV 40 >XP_017638346.1 PREDICTED: elongator complex protein 5 isoform X1 [Gossypium arboreum] Length = 377 Score = 71.2 bits (173), Expect = 4e-12 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +1 Query: 247 MAESICRYLRDGALEGELAPTLTIKDSLASPFAFDVFSHI 366 MAESICR LRDGALEGELAP LTIKDS+ASPFA VFSH+ Sbjct: 1 MAESICRALRDGALEGELAPALTIKDSVASPFALQVFSHV 40 >XP_016723879.1 PREDICTED: elongator complex protein 5 isoform X1 [Gossypium hirsutum] XP_016723897.1 PREDICTED: elongator complex protein 5 isoform X1 [Gossypium hirsutum] Length = 377 Score = 71.2 bits (173), Expect = 4e-12 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +1 Query: 247 MAESICRYLRDGALEGELAPTLTIKDSLASPFAFDVFSHI 366 MAESICR LRDGALEGELAP LTIKDS+ASPFA VFSH+ Sbjct: 1 MAESICRALRDGALEGELAPALTIKDSVASPFALQVFSHV 40 >XP_015946172.1 PREDICTED: elongator complex protein 5 [Arachis duranensis] Length = 368 Score = 70.9 bits (172), Expect = 6e-12 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +1 Query: 247 MAESICRYLRDGALEGELAPTLTIKDSLASPFAFDVFSHI 366 MAES+CR LRDG LEGELAP LTIKDSL+SPF F+VFSHI Sbjct: 1 MAESVCRSLRDGVLEGELAPALTIKDSLSSPFGFNVFSHI 40 >XP_010108851.1 hypothetical protein L484_027044 [Morus notabilis] EXC20491.1 hypothetical protein L484_027044 [Morus notabilis] Length = 366 Score = 69.7 bits (169), Expect = 1e-11 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +1 Query: 247 MAESICRYLRDGALEGELAPTLTIKDSLASPFAFDVFSHI 366 MA+SICR LRDGALEGE AP LTIKD++ASPF FDVFSH+ Sbjct: 1 MADSICRALRDGALEGEHAPALTIKDNIASPFGFDVFSHV 40