BLASTX nr result
ID: Glycyrrhiza33_contig00018501
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00018501 (367 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU24693.1 hypothetical protein TSUD_323020 [Trifolium subterran... 59 1e-07 XP_004493075.1 PREDICTED: RING finger protein 10 [Cicer arietinum] 57 4e-07 >GAU24693.1 hypothetical protein TSUD_323020 [Trifolium subterraneum] Length = 744 Score = 58.5 bits (140), Expect = 1e-07 Identities = 32/42 (76%), Positives = 33/42 (78%) Frame = -3 Query: 128 HALGSLQISDHNDPDLSAPAAEESGGPSEKVTESGSPSGMKA 3 HALGSLQISD+ P S PAAE SGGPSEKVTE S SGMKA Sbjct: 42 HALGSLQISDYPGP--STPAAENSGGPSEKVTELESSSGMKA 81 >XP_004493075.1 PREDICTED: RING finger protein 10 [Cicer arietinum] Length = 747 Score = 57.4 bits (137), Expect = 4e-07 Identities = 31/42 (73%), Positives = 33/42 (78%) Frame = -3 Query: 128 HALGSLQISDHNDPDLSAPAAEESGGPSEKVTESGSPSGMKA 3 HALGSLQISD+ P S PAAE +GG SEKVTE GS SGMKA Sbjct: 42 HALGSLQISDYPGP--STPAAENTGGSSEKVTELGSSSGMKA 81