BLASTX nr result
ID: Glycyrrhiza33_contig00018328
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00018328 (381 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016206678.1 PREDICTED: elongation of fatty acids protein 3-li... 124 1e-32 KYP36005.1 Putative elongation of fatty acids protein 1 [Cajanus... 121 2e-31 KHN00566.1 hypothetical protein glysoja_000234 [Glycine soja] 115 1e-30 XP_007156013.1 hypothetical protein PHAVU_003G251300g [Phaseolus... 119 6e-30 XP_004509237.1 PREDICTED: elongation of fatty acids protein 3-li... 118 8e-30 KHN44507.1 hypothetical protein glysoja_035739 [Glycine soja] 113 1e-29 XP_017424151.1 PREDICTED: elongation of fatty acids protein 3-li... 116 2e-29 XP_003629499.1 GNS1/SUR4 membrane family protein [Medicago trunc... 116 3e-29 XP_019446776.1 PREDICTED: elongation of fatty acids protein 3-li... 115 6e-29 XP_003518054.1 PREDICTED: elongation of fatty acids protein 3-li... 113 3e-28 KRH08321.1 hypothetical protein GLYMA_16G142200 [Glycine max] 113 3e-28 XP_014507646.1 PREDICTED: elongation of fatty acids protein 3-li... 111 2e-27 KNA15430.1 hypothetical protein SOVF_098340 [Spinacia oleracea] 111 2e-27 XP_009768917.1 PREDICTED: elongation of fatty acids protein 3-li... 110 3e-27 XP_019242728.1 PREDICTED: elongation of fatty acids protein 3-li... 110 3e-27 XP_002310199.1 hypothetical protein POPTR_0007s12290g [Populus t... 110 5e-27 KMT08507.1 hypothetical protein BVRB_6g137920 [Beta vulgaris sub... 108 7e-27 OAY33920.1 hypothetical protein MANES_13G135800 [Manihot esculenta] 110 8e-27 XP_011025707.1 PREDICTED: elongation of fatty acids protein 3-li... 109 9e-27 XP_016509185.1 PREDICTED: elongation of fatty acids protein 3-li... 109 1e-26 >XP_016206678.1 PREDICTED: elongation of fatty acids protein 3-like [Arachis ipaensis] Length = 286 Score = 124 bits (312), Expect = 1e-32 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = -1 Query: 378 ACFPFVLNCQIVLLGCNVACHVGVFMLHFFFKGGCNGIGAWVFNSVLNTAVLMLFLNFY 202 ACFPFVLNCQI LLGCNVACHVGVF+LHFFFKGGCNGIGAWVFNSVLN AVL+LFLNFY Sbjct: 188 ACFPFVLNCQIALLGCNVACHVGVFLLHFFFKGGCNGIGAWVFNSVLNGAVLLLFLNFY 246 >KYP36005.1 Putative elongation of fatty acids protein 1 [Cajanus cajan] Length = 291 Score = 121 bits (304), Expect = 2e-31 Identities = 54/60 (90%), Positives = 56/60 (93%) Frame = -1 Query: 381 AACFPFVLNCQIVLLGCNVACHVGVFMLHFFFKGGCNGIGAWVFNSVLNTAVLMLFLNFY 202 AACFPFVLNCQI LLGCNVACHV VF+LHFFFKG CNGIGAW+FNSVLN AVLMLFLNFY Sbjct: 203 AACFPFVLNCQIALLGCNVACHVAVFLLHFFFKGSCNGIGAWLFNSVLNFAVLMLFLNFY 262 >KHN00566.1 hypothetical protein glysoja_000234 [Glycine soja] Length = 141 Score = 115 bits (288), Expect = 1e-30 Identities = 50/59 (84%), Positives = 54/59 (91%) Frame = -1 Query: 378 ACFPFVLNCQIVLLGCNVACHVGVFMLHFFFKGGCNGIGAWVFNSVLNTAVLMLFLNFY 202 ACFPFVL+CQIVLL CNVACHV VF LHFF KGGCNGIGAW+FNS+LN A+LMLFLNFY Sbjct: 61 ACFPFVLSCQIVLLACNVACHVAVFFLHFFLKGGCNGIGAWLFNSILNLALLMLFLNFY 119 >XP_007156013.1 hypothetical protein PHAVU_003G251300g [Phaseolus vulgaris] ESW28007.1 hypothetical protein PHAVU_003G251300g [Phaseolus vulgaris] Length = 330 Score = 119 bits (297), Expect = 6e-30 Identities = 52/59 (88%), Positives = 54/59 (91%) Frame = -1 Query: 378 ACFPFVLNCQIVLLGCNVACHVGVFMLHFFFKGGCNGIGAWVFNSVLNTAVLMLFLNFY 202 ACFPFVLNCQI LL CNVACHVGVF LHFFFKGGCNGIGAW+FN VLN A+LMLFLNFY Sbjct: 246 ACFPFVLNCQIALLACNVACHVGVFFLHFFFKGGCNGIGAWLFNCVLNLALLMLFLNFY 304 >XP_004509237.1 PREDICTED: elongation of fatty acids protein 3-like [Cicer arietinum] Length = 308 Score = 118 bits (295), Expect = 8e-30 Identities = 52/61 (85%), Positives = 60/61 (98%), Gaps = 1/61 (1%) Frame = -1 Query: 381 AACFPFVLNCQIVLLGCNVACHVGVFMLHFFF-KGGCNGIGAWVFNSVLNTAVLMLFLNF 205 +ACFPFVLNCQIVLLGCNVACHVGVF+LHFFF +GGCNGIGAW+FNSVLNTAVL++F++F Sbjct: 211 SACFPFVLNCQIVLLGCNVACHVGVFLLHFFFLQGGCNGIGAWLFNSVLNTAVLLIFVHF 270 Query: 204 Y 202 Y Sbjct: 271 Y 271 >KHN44507.1 hypothetical protein glysoja_035739 [Glycine soja] Length = 150 Score = 113 bits (283), Expect = 1e-29 Identities = 50/59 (84%), Positives = 53/59 (89%) Frame = -1 Query: 378 ACFPFVLNCQIVLLGCNVACHVGVFMLHFFFKGGCNGIGAWVFNSVLNTAVLMLFLNFY 202 ACFPFVL+CQIVLL CNVACHV VF LHFF KGGCNGIGAWVFNS+LN A+LML LNFY Sbjct: 68 ACFPFVLSCQIVLLACNVACHVAVFFLHFFLKGGCNGIGAWVFNSILNLALLMLSLNFY 126 >XP_017424151.1 PREDICTED: elongation of fatty acids protein 3-like [Vigna angularis] KOM32324.1 hypothetical protein LR48_Vigan01g188000 [Vigna angularis] BAT75501.1 hypothetical protein VIGAN_01337300 [Vigna angularis var. angularis] Length = 290 Score = 116 bits (291), Expect = 2e-29 Identities = 51/59 (86%), Positives = 53/59 (89%) Frame = -1 Query: 378 ACFPFVLNCQIVLLGCNVACHVGVFMLHFFFKGGCNGIGAWVFNSVLNTAVLMLFLNFY 202 ACFPFVLNCQI LL CNVACHVGVF LHFFFKGGCNGIGAW+FN VLN A+L LFLNFY Sbjct: 207 ACFPFVLNCQIALLACNVACHVGVFFLHFFFKGGCNGIGAWLFNCVLNLALLTLFLNFY 265 >XP_003629499.1 GNS1/SUR4 membrane family protein [Medicago truncatula] AET03975.1 GNS1/SUR4 membrane family protein [Medicago truncatula] Length = 313 Score = 116 bits (291), Expect = 3e-29 Identities = 50/61 (81%), Positives = 60/61 (98%), Gaps = 1/61 (1%) Frame = -1 Query: 381 AACFPFVLNCQIVLLGCNVACHVGVFMLHFFFK-GGCNGIGAWVFNSVLNTAVLMLFLNF 205 +ACFPFVLNCQI+LLGCNVACHVGVF+LHFFF+ GGCNG+GAWVFNS+LNTAVL++F++F Sbjct: 215 SACFPFVLNCQILLLGCNVACHVGVFLLHFFFEVGGCNGMGAWVFNSILNTAVLVIFIHF 274 Query: 204 Y 202 Y Sbjct: 275 Y 275 >XP_019446776.1 PREDICTED: elongation of fatty acids protein 3-like [Lupinus angustifolius] OIW09729.1 hypothetical protein TanjilG_09402 [Lupinus angustifolius] Length = 294 Score = 115 bits (288), Expect = 6e-29 Identities = 52/59 (88%), Positives = 53/59 (89%) Frame = -1 Query: 378 ACFPFVLNCQIVLLGCNVACHVGVFMLHFFFKGGCNGIGAWVFNSVLNTAVLMLFLNFY 202 ACFPFVLNCQIVLL CNV CHVGVF LHFFFKGGCNGI AWVFNSVLN AVL+L LNFY Sbjct: 212 ACFPFVLNCQIVLLSCNVVCHVGVFFLHFFFKGGCNGIRAWVFNSVLNMAVLILCLNFY 270 >XP_003518054.1 PREDICTED: elongation of fatty acids protein 3-like [Glycine max] KRH69956.1 hypothetical protein GLYMA_02G059300 [Glycine max] Length = 282 Score = 113 bits (283), Expect = 3e-28 Identities = 48/59 (81%), Positives = 53/59 (89%) Frame = -1 Query: 378 ACFPFVLNCQIVLLGCNVACHVGVFMLHFFFKGGCNGIGAWVFNSVLNTAVLMLFLNFY 202 ACFPFVL+CQI LL CN+ACHV VF LHFF KGGCNGIGAW+FNS+LN A+LMLFLNFY Sbjct: 202 ACFPFVLSCQIALLACNIACHVAVFFLHFFLKGGCNGIGAWLFNSILNLALLMLFLNFY 260 >KRH08321.1 hypothetical protein GLYMA_16G142200 [Glycine max] Length = 291 Score = 113 bits (283), Expect = 3e-28 Identities = 50/59 (84%), Positives = 53/59 (89%) Frame = -1 Query: 378 ACFPFVLNCQIVLLGCNVACHVGVFMLHFFFKGGCNGIGAWVFNSVLNTAVLMLFLNFY 202 ACFPFVL+CQIVLL CNVACHV VF LHFF KGGCNGIGAWVFNS+LN A+LML LNFY Sbjct: 209 ACFPFVLSCQIVLLACNVACHVAVFFLHFFLKGGCNGIGAWVFNSILNLALLMLSLNFY 267 >XP_014507646.1 PREDICTED: elongation of fatty acids protein 3-like [Vigna radiata var. radiata] Length = 290 Score = 111 bits (277), Expect = 2e-27 Identities = 49/59 (83%), Positives = 51/59 (86%) Frame = -1 Query: 378 ACFPFVLNCQIVLLGCNVACHVGVFMLHFFFKGGCNGIGAWVFNSVLNTAVLMLFLNFY 202 ACFPFVLNCQI LL CNVACHVGVF LHFF KGGCNGIGAW+FN VLN A+L L LNFY Sbjct: 207 ACFPFVLNCQIALLACNVACHVGVFFLHFFLKGGCNGIGAWLFNCVLNLALLTLSLNFY 265 >KNA15430.1 hypothetical protein SOVF_098340 [Spinacia oleracea] Length = 309 Score = 111 bits (278), Expect = 2e-27 Identities = 50/59 (84%), Positives = 54/59 (91%) Frame = -1 Query: 378 ACFPFVLNCQIVLLGCNVACHVGVFMLHFFFKGGCNGIGAWVFNSVLNTAVLMLFLNFY 202 ACFPFVLNCQIVLLGCN+ CHVGV ++H FFKGGCNGIGAW FNSVLNTA+L LFLNFY Sbjct: 219 ACFPFVLNCQIVLLGCNLICHVGVLLMH-FFKGGCNGIGAWGFNSVLNTAILSLFLNFY 276 >XP_009768917.1 PREDICTED: elongation of fatty acids protein 3-like [Nicotiana sylvestris] XP_016452974.1 PREDICTED: elongation of fatty acids protein 3-like [Nicotiana tabacum] Length = 288 Score = 110 bits (276), Expect = 3e-27 Identities = 47/60 (78%), Positives = 52/60 (86%) Frame = -1 Query: 381 AACFPFVLNCQIVLLGCNVACHVGVFMLHFFFKGGCNGIGAWVFNSVLNTAVLMLFLNFY 202 +ACFPFV CQIVLLGCN+ CHVGV +LHF +GGCNGIGAWVFNSVLN A+L LFLNFY Sbjct: 205 SACFPFVAGCQIVLLGCNIVCHVGVLLLHFMKRGGCNGIGAWVFNSVLNAAILFLFLNFY 264 >XP_019242728.1 PREDICTED: elongation of fatty acids protein 3-like [Nicotiana attenuata] OIT05804.1 elongation of fatty acids protein 3-like protein [Nicotiana attenuata] Length = 289 Score = 110 bits (276), Expect = 3e-27 Identities = 47/60 (78%), Positives = 52/60 (86%) Frame = -1 Query: 381 AACFPFVLNCQIVLLGCNVACHVGVFMLHFFFKGGCNGIGAWVFNSVLNTAVLMLFLNFY 202 +ACFPFV CQIVLLGCN+ CHVGV +LHF +GGCNGIGAWVFNSVLN A+L LFLNFY Sbjct: 205 SACFPFVAGCQIVLLGCNIVCHVGVLLLHFMKRGGCNGIGAWVFNSVLNAAILFLFLNFY 264 >XP_002310199.1 hypothetical protein POPTR_0007s12290g [Populus trichocarpa] EEE90649.1 hypothetical protein POPTR_0007s12290g [Populus trichocarpa] Length = 279 Score = 110 bits (274), Expect = 5e-27 Identities = 51/60 (85%), Positives = 53/60 (88%) Frame = -1 Query: 381 AACFPFVLNCQIVLLGCNVACHVGVFMLHFFFKGGCNGIGAWVFNSVLNTAVLMLFLNFY 202 +ACFPFVLNCQIVLLGCNVACHVGV LH F KGGCNGIGAW FNSVLN A+L LFLNFY Sbjct: 205 SACFPFVLNCQIVLLGCNVACHVGVLSLH-FMKGGCNGIGAWWFNSVLNGAILFLFLNFY 263 >KMT08507.1 hypothetical protein BVRB_6g137920 [Beta vulgaris subsp. vulgaris] Length = 227 Score = 108 bits (270), Expect = 7e-27 Identities = 48/60 (80%), Positives = 54/60 (90%) Frame = -1 Query: 381 AACFPFVLNCQIVLLGCNVACHVGVFMLHFFFKGGCNGIGAWVFNSVLNTAVLMLFLNFY 202 +ACFPFVLNCQIVLLGCN+ CHVGV ++H F KGGCNGIGAW FNSVLNTA+L LFLN+Y Sbjct: 131 SACFPFVLNCQIVLLGCNLICHVGVLLMH-FLKGGCNGIGAWGFNSVLNTAILSLFLNYY 189 >OAY33920.1 hypothetical protein MANES_13G135800 [Manihot esculenta] Length = 299 Score = 110 bits (274), Expect = 8e-27 Identities = 48/60 (80%), Positives = 56/60 (93%) Frame = -1 Query: 381 AACFPFVLNCQIVLLGCNVACHVGVFMLHFFFKGGCNGIGAWVFNSVLNTAVLMLFLNFY 202 +ACFPFV+NCQ+VLLGCN+ACHVGV +LH F KGGCNGIGAW+FNSVLN A+L+LFLNFY Sbjct: 208 SACFPFVVNCQMVLLGCNLACHVGVLLLH-FMKGGCNGIGAWLFNSVLNGAILLLFLNFY 266 >XP_011025707.1 PREDICTED: elongation of fatty acids protein 3-like [Populus euphratica] Length = 289 Score = 109 bits (273), Expect = 9e-27 Identities = 51/59 (86%), Positives = 52/59 (88%) Frame = -1 Query: 378 ACFPFVLNCQIVLLGCNVACHVGVFMLHFFFKGGCNGIGAWVFNSVLNTAVLMLFLNFY 202 ACFPFVLNCQIVLLGCNVACHVGV LH F KGGCNGIGAW FNSVLN A+L LFLNFY Sbjct: 206 ACFPFVLNCQIVLLGCNVACHVGVLSLH-FLKGGCNGIGAWWFNSVLNGAILFLFLNFY 263 >XP_016509185.1 PREDICTED: elongation of fatty acids protein 3-like [Nicotiana tabacum] Length = 288 Score = 109 bits (272), Expect = 1e-26 Identities = 47/60 (78%), Positives = 52/60 (86%) Frame = -1 Query: 381 AACFPFVLNCQIVLLGCNVACHVGVFMLHFFFKGGCNGIGAWVFNSVLNTAVLMLFLNFY 202 +ACFPFV +CQIVLLGCNV CHVGV +LHF +GGCNGIGAWVFNSVLN A+L L LNFY Sbjct: 205 SACFPFVASCQIVLLGCNVVCHVGVLLLHFMKRGGCNGIGAWVFNSVLNAAILFLLLNFY 264