BLASTX nr result
ID: Glycyrrhiza33_contig00018128
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00018128 (358 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP70554.1 Serine/threonine-protein kinase Nek6 [Cajanus cajan] 87 1e-17 XP_006604372.1 PREDICTED: serine/threonine-protein kinase Nek6-l... 86 5e-17 XP_014496123.1 PREDICTED: serine/threonine-protein kinase Nek6-l... 85 9e-17 XP_017419118.1 PREDICTED: serine/threonine-protein kinase Nek6-l... 85 9e-17 XP_007162254.1 hypothetical protein PHAVU_001G137000g [Phaseolus... 84 1e-16 XP_004493532.1 PREDICTED: serine/threonine-protein kinase Nek6 [... 83 4e-16 KHN07396.1 Serine/threonine-protein kinase Nek6 [Glycine soja] 82 8e-16 XP_006576836.1 PREDICTED: serine/threonine-protein kinase Nek6-l... 82 8e-16 GAU36914.1 hypothetical protein TSUD_331870 [Trifolium subterran... 79 7e-15 XP_015969495.1 PREDICTED: serine/threonine-protein kinase Nek6-l... 79 9e-15 XP_016204967.1 PREDICTED: serine/threonine-protein kinase Nek6-l... 79 9e-15 OIW11442.1 hypothetical protein TanjilG_26808 [Lupinus angustifo... 79 1e-14 XP_019444108.1 PREDICTED: serine/threonine-protein kinase Nek6-l... 79 1e-14 XP_019444101.1 PREDICTED: serine/threonine-protein kinase Nek6-l... 79 1e-14 KGN54884.1 hypothetical protein Csa_4G572290 [Cucumis sativus] 75 2e-14 GAV63910.1 Pkinase domain-containing protein [Cephalotus follicu... 78 2e-14 XP_003625183.2 Serine/Threonine kinase family protein [Medicago ... 77 3e-14 XP_015866152.1 PREDICTED: serine/threonine-protein kinase Nek6-l... 77 4e-14 XP_015899035.1 PREDICTED: serine/threonine-protein kinase Nek6 [... 77 4e-14 XP_019425897.1 PREDICTED: serine/threonine-protein kinase Nek6-l... 77 6e-14 >KYP70554.1 Serine/threonine-protein kinase Nek6 [Cajanus cajan] Length = 586 Score = 87.0 bits (214), Expect = 1e-17 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +3 Query: 225 METDNGDMRSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 356 MET+NGD RSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL Sbjct: 1 METENGDTRSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 44 >XP_006604372.1 PREDICTED: serine/threonine-protein kinase Nek6-like [Glycine max] XP_014627508.1 PREDICTED: serine/threonine-protein kinase Nek6-like [Glycine max] KHN26346.1 Serine/threonine-protein kinase Nek6 [Glycine soja] KRG95312.1 hypothetical protein GLYMA_19G143000 [Glycine max] KRG95313.1 hypothetical protein GLYMA_19G143000 [Glycine max] Length = 648 Score = 85.5 bits (210), Expect = 5e-17 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = +3 Query: 225 METDNGDMRSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 356 MET+NGD RSKKME+YEVIEQIGRGAFGSAFLVLHKSEKKRYVL Sbjct: 1 METENGDTRSKKMEEYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 44 >XP_014496123.1 PREDICTED: serine/threonine-protein kinase Nek6-like isoform X1 [Vigna radiata var. radiata] Length = 637 Score = 84.7 bits (208), Expect = 9e-17 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = +3 Query: 225 METDNGDMRSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 356 MET+NGD +S+KMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL Sbjct: 1 METENGDTKSRKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 44 >XP_017419118.1 PREDICTED: serine/threonine-protein kinase Nek6-like isoform X1 [Vigna angularis] KOM38807.1 hypothetical protein LR48_Vigan03g218900 [Vigna angularis] BAT85295.1 hypothetical protein VIGAN_04282400 [Vigna angularis var. angularis] Length = 637 Score = 84.7 bits (208), Expect = 9e-17 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = +3 Query: 225 METDNGDMRSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 356 MET+NGD +S+KMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL Sbjct: 1 METENGDTKSRKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 44 >XP_007162254.1 hypothetical protein PHAVU_001G137000g [Phaseolus vulgaris] ESW34248.1 hypothetical protein PHAVU_001G137000g [Phaseolus vulgaris] Length = 639 Score = 84.3 bits (207), Expect = 1e-16 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = +3 Query: 225 METDNGDMRSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 356 MET+NGD +SKKME+YEVIEQIGRGAFGSAFLVLHKSEKKRYVL Sbjct: 1 METENGDTKSKKMEEYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 44 >XP_004493532.1 PREDICTED: serine/threonine-protein kinase Nek6 [Cicer arietinum] XP_004493533.1 PREDICTED: serine/threonine-protein kinase Nek6 [Cicer arietinum] XP_004493534.1 PREDICTED: serine/threonine-protein kinase Nek6 [Cicer arietinum] Length = 637 Score = 82.8 bits (203), Expect = 4e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +3 Query: 225 METDNGDMRSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 356 ME +NG+M+SKKME+YEVIEQIGRGAFGSAFLVLHKSEKKRYVL Sbjct: 1 MEIENGEMKSKKMEEYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 44 >KHN07396.1 Serine/threonine-protein kinase Nek6 [Glycine soja] Length = 648 Score = 82.0 bits (201), Expect = 8e-16 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +3 Query: 225 METDNGDMRSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 356 ME +NGD RSKKME+Y+VIEQIGRGAFGSAFLVLHKSEKKRYVL Sbjct: 1 MEIENGDTRSKKMEEYQVIEQIGRGAFGSAFLVLHKSEKKRYVL 44 >XP_006576836.1 PREDICTED: serine/threonine-protein kinase Nek6-like isoform X1 [Glycine max] KRH66991.1 hypothetical protein GLYMA_03G140100 [Glycine max] Length = 648 Score = 82.0 bits (201), Expect = 8e-16 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +3 Query: 225 METDNGDMRSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 356 ME +NGD RSKKME+Y+VIEQIGRGAFGSAFLVLHKSEKKRYVL Sbjct: 1 MEIENGDTRSKKMEEYQVIEQIGRGAFGSAFLVLHKSEKKRYVL 44 >GAU36914.1 hypothetical protein TSUD_331870 [Trifolium subterraneum] Length = 635 Score = 79.3 bits (194), Expect = 7e-15 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +3 Query: 225 METDNGDMRSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 356 ME +N +M+SKKME+YEVIEQIGRGAFG+AFLVLHKSEKKRYVL Sbjct: 1 MEIENSEMKSKKMEEYEVIEQIGRGAFGAAFLVLHKSEKKRYVL 44 >XP_015969495.1 PREDICTED: serine/threonine-protein kinase Nek6-like [Arachis duranensis] Length = 660 Score = 79.0 bits (193), Expect = 9e-15 Identities = 40/45 (88%), Positives = 42/45 (93%), Gaps = 1/45 (2%) Frame = +3 Query: 225 METDNG-DMRSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 356 METDN + +SKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL Sbjct: 1 METDNNSESKSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 45 >XP_016204967.1 PREDICTED: serine/threonine-protein kinase Nek6-like [Arachis ipaensis] Length = 661 Score = 79.0 bits (193), Expect = 9e-15 Identities = 40/45 (88%), Positives = 42/45 (93%), Gaps = 1/45 (2%) Frame = +3 Query: 225 METDNG-DMRSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 356 METDN + +SKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL Sbjct: 1 METDNNSESKSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 45 >OIW11442.1 hypothetical protein TanjilG_26808 [Lupinus angustifolius] Length = 632 Score = 78.6 bits (192), Expect = 1e-14 Identities = 40/46 (86%), Positives = 42/46 (91%), Gaps = 2/46 (4%) Frame = +3 Query: 225 METDNG--DMRSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 356 METDN D RSKK+EDYEVIEQIGRGAFG+AFLVLHKSEKKRYVL Sbjct: 1 METDNNNSDTRSKKIEDYEVIEQIGRGAFGAAFLVLHKSEKKRYVL 46 >XP_019444108.1 PREDICTED: serine/threonine-protein kinase Nek6-like isoform X3 [Lupinus angustifolius] Length = 645 Score = 78.6 bits (192), Expect = 1e-14 Identities = 40/46 (86%), Positives = 42/46 (91%), Gaps = 2/46 (4%) Frame = +3 Query: 225 METDNG--DMRSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 356 METDN D RSKK+EDYEVIEQIGRGAFG+AFLVLHKSEKKRYVL Sbjct: 1 METDNNNSDTRSKKIEDYEVIEQIGRGAFGAAFLVLHKSEKKRYVL 46 >XP_019444101.1 PREDICTED: serine/threonine-protein kinase Nek6-like isoform X1 [Lupinus angustifolius] XP_019444102.1 PREDICTED: serine/threonine-protein kinase Nek6-like isoform X1 [Lupinus angustifolius] XP_019444103.1 PREDICTED: serine/threonine-protein kinase Nek6-like isoform X1 [Lupinus angustifolius] XP_019444104.1 PREDICTED: serine/threonine-protein kinase Nek6-like isoform X1 [Lupinus angustifolius] XP_019444105.1 PREDICTED: serine/threonine-protein kinase Nek6-like isoform X1 [Lupinus angustifolius] XP_019444106.1 PREDICTED: serine/threonine-protein kinase Nek6-like isoform X2 [Lupinus angustifolius] XP_019444107.1 PREDICTED: serine/threonine-protein kinase Nek6-like isoform X2 [Lupinus angustifolius] Length = 659 Score = 78.6 bits (192), Expect = 1e-14 Identities = 40/46 (86%), Positives = 42/46 (91%), Gaps = 2/46 (4%) Frame = +3 Query: 225 METDNG--DMRSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 356 METDN D RSKK+EDYEVIEQIGRGAFG+AFLVLHKSEKKRYVL Sbjct: 1 METDNNNSDTRSKKIEDYEVIEQIGRGAFGAAFLVLHKSEKKRYVL 46 >KGN54884.1 hypothetical protein Csa_4G572290 [Cucumis sativus] Length = 181 Score = 75.1 bits (183), Expect = 2e-14 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = +3 Query: 225 METDNGDMRSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 356 ME+DNGDM+++ MEDYEVIEQIGRGAFGSAFLV HK+EKK+YVL Sbjct: 1 MESDNGDMKTR-MEDYEVIEQIGRGAFGSAFLVYHKTEKKKYVL 43 >GAV63910.1 Pkinase domain-containing protein [Cephalotus follicularis] Length = 645 Score = 78.2 bits (191), Expect = 2e-14 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 225 METDNGDMRSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 356 METDNGD++SK MEDYEVIEQIGRGAFG+AFLVLHK+EKK+YVL Sbjct: 1 METDNGDVKSK-MEDYEVIEQIGRGAFGAAFLVLHKNEKKKYVL 43 >XP_003625183.2 Serine/Threonine kinase family protein [Medicago truncatula] AES81401.2 Serine/Threonine kinase family protein [Medicago truncatula] Length = 642 Score = 77.4 bits (189), Expect = 3e-14 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +3 Query: 225 METDNGDMRSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 356 ME +N M+SKKME+YEVIEQIGRGAFG+AFLVLHKSEKKRYVL Sbjct: 1 MEIENSVMKSKKMEEYEVIEQIGRGAFGAAFLVLHKSEKKRYVL 44 >XP_015866152.1 PREDICTED: serine/threonine-protein kinase Nek6-like [Ziziphus jujuba] XP_015866153.1 PREDICTED: serine/threonine-protein kinase Nek6-like [Ziziphus jujuba] Length = 650 Score = 77.0 bits (188), Expect = 4e-14 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +3 Query: 225 METDNGDMRSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 356 METDNGDM+SK MEDYEVIEQIGRGAFG+AFLVLHK EKK++VL Sbjct: 1 METDNGDMKSK-MEDYEVIEQIGRGAFGAAFLVLHKIEKKKFVL 43 >XP_015899035.1 PREDICTED: serine/threonine-protein kinase Nek6 [Ziziphus jujuba] XP_015899036.1 PREDICTED: serine/threonine-protein kinase Nek6 [Ziziphus jujuba] Length = 650 Score = 77.0 bits (188), Expect = 4e-14 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +3 Query: 225 METDNGDMRSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 356 METDNGDM+SK MEDYEVIEQIGRGAFG+AFLVLHK EKK++VL Sbjct: 1 METDNGDMKSK-MEDYEVIEQIGRGAFGAAFLVLHKIEKKKFVL 43 >XP_019425897.1 PREDICTED: serine/threonine-protein kinase Nek6-like [Lupinus angustifolius] OIV92342.1 hypothetical protein TanjilG_10552 [Lupinus angustifolius] Length = 667 Score = 76.6 bits (187), Expect = 6e-14 Identities = 40/47 (85%), Positives = 40/47 (85%), Gaps = 3/47 (6%) Frame = +3 Query: 225 METDNG---DMRSKKMEDYEVIEQIGRGAFGSAFLVLHKSEKKRYVL 356 ME DN D RSKKMEDYEVIEQIGRGAFGSAFLVLH SEKKRYVL Sbjct: 1 MEIDNSNSSDARSKKMEDYEVIEQIGRGAFGSAFLVLHNSEKKRYVL 47