BLASTX nr result
ID: Glycyrrhiza33_contig00018079
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00018079 (524 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACG32217.1 hypothetical protein [Zea mays] 55 2e-06 XP_019456290.1 PREDICTED: topless-related protein 2-like isoform... 57 3e-06 OIW18383.1 hypothetical protein TanjilG_31523 [Lupinus angustifo... 57 3e-06 XP_019456283.1 PREDICTED: topless-related protein 2-like isoform... 57 3e-06 XP_019456274.1 PREDICTED: topless-related protein 2-like isoform... 57 3e-06 XP_003609722.2 topless-like protein [Medicago truncatula] AES919... 57 3e-06 XP_004508183.1 PREDICTED: topless-related protein 2 [Cicer ariet... 57 3e-06 GAU33102.1 hypothetical protein TSUD_259530, partial [Trifolium ... 56 4e-06 AFJ42410.1 Ramosa1 enhancer locus 2 protein, partial [Sorghum bi... 54 4e-06 AFJ42409.1 Ramosa1 enhancer locus 2 protein, partial [Cymbopogon... 54 4e-06 AFJ42407.1 Ramosa1 enhancer locus 2 protein, partial [Loudetia s... 54 4e-06 AFJ42403.1 Ramosa1 enhancer locus 2 protein, partial [Phacelurus... 54 4e-06 CDY50502.1 BnaC01g44400D [Brassica napus] 56 4e-06 ACJ86249.1 unknown [Medicago truncatula] 54 5e-06 EPS70365.1 hypothetical protein M569_04393, partial [Genlisea au... 56 6e-06 ONK78925.1 uncharacterized protein A4U43_C01F1060 [Asparagus off... 56 6e-06 KRH33863.1 hypothetical protein GLYMA_10G1500001, partial [Glyci... 55 7e-06 ONL96159.1 topless-related2, partial [Zea mays] 55 7e-06 ADE77220.1 unknown [Picea sitchensis] 54 7e-06 ONL96171.1 topless-related2 [Zea mays] 55 8e-06 >ACG32217.1 hypothetical protein [Zea mays] Length = 178 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -1 Query: 86 MTSLSRELVFLILQFLEEEKFKETVHKL 3 MTSLSRELVFLILQFL+EEKFKETVHKL Sbjct: 1 MTSLSRELVFLILQFLDEEKFKETVHKL 28 >XP_019456290.1 PREDICTED: topless-related protein 2-like isoform X3 [Lupinus angustifolius] Length = 1091 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 86 MTSLSRELVFLILQFLEEEKFKETVHKL 3 MTSLSRELVFLILQFLEEEKFKETVHKL Sbjct: 1 MTSLSRELVFLILQFLEEEKFKETVHKL 28 >OIW18383.1 hypothetical protein TanjilG_31523 [Lupinus angustifolius] Length = 1094 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 86 MTSLSRELVFLILQFLEEEKFKETVHKL 3 MTSLSRELVFLILQFLEEEKFKETVHKL Sbjct: 1 MTSLSRELVFLILQFLEEEKFKETVHKL 28 >XP_019456283.1 PREDICTED: topless-related protein 2-like isoform X2 [Lupinus angustifolius] Length = 1118 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 86 MTSLSRELVFLILQFLEEEKFKETVHKL 3 MTSLSRELVFLILQFLEEEKFKETVHKL Sbjct: 1 MTSLSRELVFLILQFLEEEKFKETVHKL 28 >XP_019456274.1 PREDICTED: topless-related protein 2-like isoform X1 [Lupinus angustifolius] Length = 1122 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 86 MTSLSRELVFLILQFLEEEKFKETVHKL 3 MTSLSRELVFLILQFLEEEKFKETVHKL Sbjct: 1 MTSLSRELVFLILQFLEEEKFKETVHKL 28 >XP_003609722.2 topless-like protein [Medicago truncatula] AES91919.2 topless-like protein [Medicago truncatula] Length = 1122 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 86 MTSLSRELVFLILQFLEEEKFKETVHKL 3 MTSLSRELVFLILQFLEEEKFKETVHKL Sbjct: 1 MTSLSRELVFLILQFLEEEKFKETVHKL 28 >XP_004508183.1 PREDICTED: topless-related protein 2 [Cicer arietinum] Length = 1125 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 86 MTSLSRELVFLILQFLEEEKFKETVHKL 3 MTSLSRELVFLILQFLEEEKFKETVHKL Sbjct: 1 MTSLSRELVFLILQFLEEEKFKETVHKL 28 >GAU33102.1 hypothetical protein TSUD_259530, partial [Trifolium subterraneum] Length = 1023 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 98 SGAKMTSLSRELVFLILQFLEEEKFKETVHKL 3 S KM+SLSRELVFLILQFL+EEKFKETVHKL Sbjct: 9 SVVKMSSLSRELVFLILQFLDEEKFKETVHKL 40 >AFJ42410.1 Ramosa1 enhancer locus 2 protein, partial [Sorghum bicolor] Length = 144 Score = 53.9 bits (128), Expect = 4e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -1 Query: 86 MTSLSRELVFLILQFLEEEKFKETVHKL 3 M+SLSRELVFLILQFL+EEKFKETVHKL Sbjct: 1 MSSLSRELVFLILQFLDEEKFKETVHKL 28 >AFJ42409.1 Ramosa1 enhancer locus 2 protein, partial [Cymbopogon flexuosus] Length = 144 Score = 53.9 bits (128), Expect = 4e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -1 Query: 86 MTSLSRELVFLILQFLEEEKFKETVHKL 3 M+SLSRELVFLILQFL+EEKFKETVHKL Sbjct: 1 MSSLSRELVFLILQFLDEEKFKETVHKL 28 >AFJ42407.1 Ramosa1 enhancer locus 2 protein, partial [Loudetia sp. MCE-2012] Length = 144 Score = 53.9 bits (128), Expect = 4e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -1 Query: 86 MTSLSRELVFLILQFLEEEKFKETVHKL 3 M+SLSRELVFLILQFL+EEKFKETVHKL Sbjct: 1 MSSLSRELVFLILQFLDEEKFKETVHKL 28 >AFJ42403.1 Ramosa1 enhancer locus 2 protein, partial [Phacelurus digitatus] AFJ42404.1 Ramosa1 enhancer locus 2 protein, partial [Chrysopogon gryllus] AFJ42405.1 Ramosa1 enhancer locus 2 protein, partial [Andropterum stolzii] AFJ42406.1 Ramosa1 enhancer locus 2 protein, partial [Dichanthium annulatum] AFJ42408.1 Ramosa1 enhancer locus 2 protein, partial [Schizachyrium sanguineum var. hirtiflorum] Length = 144 Score = 53.9 bits (128), Expect = 4e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -1 Query: 86 MTSLSRELVFLILQFLEEEKFKETVHKL 3 M+SLSRELVFLILQFL+EEKFKETVHKL Sbjct: 1 MSSLSRELVFLILQFLDEEKFKETVHKL 28 >CDY50502.1 BnaC01g44400D [Brassica napus] Length = 1272 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 95 GAKMTSLSRELVFLILQFLEEEKFKETVHKL 3 G KM+SLSRELVFLILQFL+EEKFKE+VHKL Sbjct: 135 GEKMSSLSRELVFLILQFLDEEKFKESVHKL 165 >ACJ86249.1 unknown [Medicago truncatula] Length = 147 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -1 Query: 86 MTSLSRELVFLILQFLEEEKFKETVHKL 3 MTSLSRELVFLILQFL+EEKFKE+VHKL Sbjct: 1 MTSLSRELVFLILQFLDEEKFKESVHKL 28 >EPS70365.1 hypothetical protein M569_04393, partial [Genlisea aurea] Length = 1140 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 95 GAKMTSLSRELVFLILQFLEEEKFKETVHKL 3 G M+SLSRELVFLILQFL+EEKFKETVHKL Sbjct: 29 GVTMSSLSRELVFLILQFLDEEKFKETVHKL 59 >ONK78925.1 uncharacterized protein A4U43_C01F1060 [Asparagus officinalis] Length = 1294 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 98 SGAKMTSLSRELVFLILQFLEEEKFKETVHKL 3 +G M+SLSRELVFLILQFL+EEKFKETVHKL Sbjct: 83 AGIAMSSLSRELVFLILQFLDEEKFKETVHKL 114 >KRH33863.1 hypothetical protein GLYMA_10G1500001, partial [Glycine max] Length = 275 Score = 55.1 bits (131), Expect = 7e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -1 Query: 86 MTSLSRELVFLILQFLEEEKFKETVHKL 3 MTSLSRELVFLILQFLEEEKFKE+VHKL Sbjct: 1 MTSLSRELVFLILQFLEEEKFKESVHKL 28 >ONL96159.1 topless-related2, partial [Zea mays] Length = 511 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -1 Query: 86 MTSLSRELVFLILQFLEEEKFKETVHKL 3 MTSLSRELVFLILQFL+EEKFKETVHKL Sbjct: 1 MTSLSRELVFLILQFLDEEKFKETVHKL 28 >ADE77220.1 unknown [Picea sitchensis] Length = 178 Score = 53.9 bits (128), Expect = 7e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -1 Query: 86 MTSLSRELVFLILQFLEEEKFKETVHKL 3 M+SLSRELVFLILQFL+EEKFKETVHKL Sbjct: 1 MSSLSRELVFLILQFLDEEKFKETVHKL 28 >ONL96171.1 topless-related2 [Zea mays] Length = 709 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -1 Query: 86 MTSLSRELVFLILQFLEEEKFKETVHKL 3 MTSLSRELVFLILQFL+EEKFKETVHKL Sbjct: 1 MTSLSRELVFLILQFLDEEKFKETVHKL 28