BLASTX nr result
ID: Glycyrrhiza33_contig00017843
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00017843 (330 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW08337.1 hypothetical protein TanjilG_03013 [Lupinus angustifo... 74 4e-13 XP_019449048.1 PREDICTED: putative pentatricopeptide repeat-cont... 74 4e-13 XP_017424931.1 PREDICTED: putative pentatricopeptide repeat-cont... 68 5e-11 XP_009379228.1 PREDICTED: putative pentatricopeptide repeat-cont... 65 5e-10 XP_007150840.1 hypothetical protein PHAVU_005G185300g [Phaseolus... 65 7e-10 XP_014501192.1 PREDICTED: putative pentatricopeptide repeat-cont... 63 3e-09 XP_008380383.1 PREDICTED: putative pentatricopeptide repeat-cont... 61 1e-08 XP_014627345.1 PREDICTED: putative pentatricopeptide repeat-cont... 59 7e-08 KRG93487.1 hypothetical protein GLYMA_19G019400 [Glycine max] 59 7e-08 XP_007217131.1 hypothetical protein PRUPE_ppa015612m2g, partial ... 58 9e-08 XP_008227981.1 PREDICTED: putative pentatricopeptide repeat-cont... 59 1e-07 ONI15037.1 hypothetical protein PRUPE_3G022400 [Prunus persica] ... 58 1e-07 ONI15036.1 hypothetical protein PRUPE_3G022400 [Prunus persica] 58 1e-07 XP_014625221.1 PREDICTED: putative pentatricopeptide repeat-cont... 58 2e-07 XP_014625206.1 PREDICTED: putative pentatricopeptide repeat-cont... 58 2e-07 XP_006465137.1 PREDICTED: putative pentatricopeptide repeat-cont... 57 3e-07 XP_016197200.1 PREDICTED: putative pentatricopeptide repeat-cont... 57 5e-07 KDO46846.1 hypothetical protein CISIN_1g006437mg [Citrus sinensis] 56 6e-07 XP_015958855.1 PREDICTED: putative pentatricopeptide repeat-cont... 56 6e-07 XP_008342596.1 PREDICTED: putative pentatricopeptide repeat-cont... 56 8e-07 >OIW08337.1 hypothetical protein TanjilG_03013 [Lupinus angustifolius] Length = 652 Score = 73.9 bits (180), Expect = 4e-13 Identities = 40/63 (63%), Positives = 46/63 (73%), Gaps = 1/63 (1%) Frame = -2 Query: 188 FSSQFPRTSSKRRSEVVLKSESVHSTLSSCPSDLIALSFFLWSAQRRR-RHDSVALDHMV 12 F S FP K ++ V+L ++VHSTLS CPSDLIALSFFLWSAQR HDS+ALD MV Sbjct: 37 FPSPFPH---KTKTNVLLNRDNVHSTLSKCPSDLIALSFFLWSAQRHGCSHDSLALDRMV 93 Query: 11 AVL 3 VL Sbjct: 94 TVL 96 >XP_019449048.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Lupinus angustifolius] XP_019449049.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Lupinus angustifolius] XP_019449050.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Lupinus angustifolius] Length = 697 Score = 73.9 bits (180), Expect = 4e-13 Identities = 40/63 (63%), Positives = 46/63 (73%), Gaps = 1/63 (1%) Frame = -2 Query: 188 FSSQFPRTSSKRRSEVVLKSESVHSTLSSCPSDLIALSFFLWSAQRRR-RHDSVALDHMV 12 F S FP K ++ V+L ++VHSTLS CPSDLIALSFFLWSAQR HDS+ALD MV Sbjct: 82 FPSPFPH---KTKTNVLLNRDNVHSTLSKCPSDLIALSFFLWSAQRHGCSHDSLALDRMV 138 Query: 11 AVL 3 VL Sbjct: 139 TVL 141 >XP_017424931.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Vigna angularis] XP_017424932.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Vigna angularis] Length = 656 Score = 67.8 bits (164), Expect = 5e-11 Identities = 42/91 (46%), Positives = 54/91 (59%), Gaps = 1/91 (1%) Frame = -2 Query: 272 MIWSWLGTSKQMKKXXXXXXXXXXTLAAFS-SQFPRTSSKRRSEVVLKSESVHSTLSSCP 96 MIWSW+ K + +A+ Q + K+R + S+S+ T+S CP Sbjct: 1 MIWSWMWRRKGTGLGWRLRLMQCHSSSAWCCGQRQKQKEKQR----VNSQSLKLTVSRCP 56 Query: 95 SDLIALSFFLWSAQRRRRHDSVALDHMVAVL 3 SDLIALSFFLW+AQ RRRHD VALDH+V VL Sbjct: 57 SDLIALSFFLWTAQ-RRRHDLVALDHIVTVL 86 >XP_009379228.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] XP_009379232.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] XP_009379233.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] XP_009379236.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] XP_009379237.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] XP_009379238.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] XP_009379239.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] XP_018507949.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Pyrus x bretschneideri] Length = 663 Score = 65.1 bits (157), Expect = 5e-10 Identities = 31/59 (52%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = -2 Query: 176 FPRTSSKRRSEVVLKSESVHSTLSSCPSDLIALSFFLWSA-QRRRRHDSVALDHMVAVL 3 FP+ + RSE++L + VHSTL C SDLIAL FFLW A QR H+ + +DHMV V+ Sbjct: 46 FPKIFDRERSELILNHQVVHSTLLKCSSDLIALRFFLWCAGQRNYFHNKIVIDHMVGVI 104 >XP_007150840.1 hypothetical protein PHAVU_005G185300g [Phaseolus vulgaris] ESW22834.1 hypothetical protein PHAVU_005G185300g [Phaseolus vulgaris] Length = 653 Score = 64.7 bits (156), Expect = 7e-10 Identities = 40/90 (44%), Positives = 51/90 (56%) Frame = -2 Query: 272 MIWSWLGTSKQMKKXXXXXXXXXXTLAAFSSQFPRTSSKRRSEVVLKSESVHSTLSSCPS 93 MIWSWL K + + SS +R+ + V S+S+ T+S CPS Sbjct: 1 MIWSWLWRRKGI------IGWRLRPMQCHSSSSASWCGQRQKQKV-NSQSLKRTVSRCPS 53 Query: 92 DLIALSFFLWSAQRRRRHDSVALDHMVAVL 3 DLIALSFFLW+AQRRR H + LDH+V VL Sbjct: 54 DLIALSFFLWTAQRRRHH-LLPLDHIVTVL 82 >XP_014501192.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Vigna radiata var. radiata] Length = 656 Score = 62.8 bits (151), Expect = 3e-09 Identities = 37/90 (41%), Positives = 51/90 (56%) Frame = -2 Query: 272 MIWSWLGTSKQMKKXXXXXXXXXXTLAAFSSQFPRTSSKRRSEVVLKSESVHSTLSSCPS 93 MIWSW+ K + +A+ K++ + + S+S+ T+S CPS Sbjct: 1 MIWSWMCRRKGTGIGWRLRLMQCHSSSAWCCG---QKQKQKEKQRVNSQSLKLTVSRCPS 57 Query: 92 DLIALSFFLWSAQRRRRHDSVALDHMVAVL 3 DLIALS FLW+AQ RRRHD A+DH+V VL Sbjct: 58 DLIALSLFLWTAQ-RRRHDMAAIDHIVTVL 86 >XP_008380383.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_008380384.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_008380385.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_008380386.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_008380387.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_008380388.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_008380390.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_008380391.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] XP_017189981.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Malus domestica] Length = 663 Score = 61.2 bits (147), Expect = 1e-08 Identities = 29/59 (49%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = -2 Query: 176 FPRTSSKRRSEVVLKSESVHSTLSSCPSDLIALSFFLWSA-QRRRRHDSVALDHMVAVL 3 F + + +SE++L + VHSTL +C SDLIAL FFLW A QR H+ + +DHMV V+ Sbjct: 46 FQKIFDREKSELILNHQVVHSTLLNCSSDLIALRFFLWCAGQRNYFHNKIVIDHMVGVI 104 >XP_014627345.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Glycine max] XP_014627346.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Glycine max] XP_014627347.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Glycine max] XP_014627348.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Glycine max] XP_014627349.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Glycine max] XP_014627350.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Glycine max] XP_014627351.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Glycine max] Length = 599 Score = 58.9 bits (141), Expect = 7e-08 Identities = 35/55 (63%), Positives = 38/55 (69%) Frame = -2 Query: 167 TSSKRRSEVVLKSESVHSTLSSCPSDLIALSFFLWSAQRRRRHDSVALDHMVAVL 3 +SSK R + SES LS CPSDLIALS FLWSAQ RRRHDS A D +V VL Sbjct: 23 SSSKWRRRNTVNSES----LSRCPSDLIALSLFLWSAQ-RRRHDSFAFDRIVTVL 72 >KRG93487.1 hypothetical protein GLYMA_19G019400 [Glycine max] Length = 603 Score = 58.9 bits (141), Expect = 7e-08 Identities = 35/55 (63%), Positives = 38/55 (69%) Frame = -2 Query: 167 TSSKRRSEVVLKSESVHSTLSSCPSDLIALSFFLWSAQRRRRHDSVALDHMVAVL 3 +SSK R + SES LS CPSDLIALS FLWSAQ RRRHDS A D +V VL Sbjct: 23 SSSKWRRRNTVNSES----LSRCPSDLIALSLFLWSAQ-RRRHDSFAFDRIVTVL 72 >XP_007217131.1 hypothetical protein PRUPE_ppa015612m2g, partial [Prunus persica] Length = 261 Score = 58.2 bits (139), Expect = 9e-08 Identities = 29/59 (49%), Positives = 37/59 (62%), Gaps = 1/59 (1%) Frame = -2 Query: 176 FPRTSSKRRSEVVLKSESVHSTLSSCPSDLIALSFFLWSAQRRR-RHDSVALDHMVAVL 3 F RS+ L ++VHSTL +CPSDLIAL FFLW AQ+ H+ + DHMV V+ Sbjct: 22 FRENLDPERSKCTLTHQNVHSTLLNCPSDLIALRFFLWCAQQPNFFHNRIVFDHMVGVI 80 >XP_008227981.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Prunus mume] XP_016648837.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Prunus mume] Length = 663 Score = 58.5 bits (140), Expect = 1e-07 Identities = 29/59 (49%), Positives = 37/59 (62%), Gaps = 1/59 (1%) Frame = -2 Query: 176 FPRTSSKRRSEVVLKSESVHSTLSSCPSDLIALSFFLWSAQRRR-RHDSVALDHMVAVL 3 F RS+ L ++VHSTL +CPSDLIAL FFLW AQ+ H+ + DHMV V+ Sbjct: 46 FQENLDPERSKCTLTHQNVHSTLLNCPSDLIALRFFLWCAQQPNFFHNRIVFDHMVGVI 104 >ONI15037.1 hypothetical protein PRUPE_3G022400 [Prunus persica] ONI15038.1 hypothetical protein PRUPE_3G022400 [Prunus persica] Length = 663 Score = 58.2 bits (139), Expect = 1e-07 Identities = 29/59 (49%), Positives = 37/59 (62%), Gaps = 1/59 (1%) Frame = -2 Query: 176 FPRTSSKRRSEVVLKSESVHSTLSSCPSDLIALSFFLWSAQRRR-RHDSVALDHMVAVL 3 F RS+ L ++VHSTL +CPSDLIAL FFLW AQ+ H+ + DHMV V+ Sbjct: 46 FRENLDPERSKCTLTHQNVHSTLLNCPSDLIALRFFLWCAQQPNFFHNRIVFDHMVGVI 104 >ONI15036.1 hypothetical protein PRUPE_3G022400 [Prunus persica] Length = 675 Score = 58.2 bits (139), Expect = 1e-07 Identities = 29/59 (49%), Positives = 37/59 (62%), Gaps = 1/59 (1%) Frame = -2 Query: 176 FPRTSSKRRSEVVLKSESVHSTLSSCPSDLIALSFFLWSAQRRR-RHDSVALDHMVAVL 3 F RS+ L ++VHSTL +CPSDLIAL FFLW AQ+ H+ + DHMV V+ Sbjct: 58 FRENLDPERSKCTLTHQNVHSTLLNCPSDLIALRFFLWCAQQPNFFHNRIVFDHMVGVI 116 >XP_014625221.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X2 [Glycine max] Length = 338 Score = 57.8 bits (138), Expect = 2e-07 Identities = 34/55 (61%), Positives = 37/55 (67%) Frame = -2 Query: 167 TSSKRRSEVVLKSESVHSTLSSCPSDLIALSFFLWSAQRRRRHDSVALDHMVAVL 3 +SSK R + SE TLS CPSDLIA S FLWSAQ RRRHDS A D +V VL Sbjct: 23 SSSKWRRRNTVNSE----TLSRCPSDLIAFSLFLWSAQ-RRRHDSFAFDRIVTVL 72 >XP_014625206.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625207.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625208.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625209.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625210.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625211.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625212.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625213.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625214.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625215.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625216.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625217.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625218.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625219.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] XP_014625220.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Glycine max] KRH05318.1 hypothetical protein GLYMA_17G219900 [Glycine max] Length = 643 Score = 57.8 bits (138), Expect = 2e-07 Identities = 34/55 (61%), Positives = 37/55 (67%) Frame = -2 Query: 167 TSSKRRSEVVLKSESVHSTLSSCPSDLIALSFFLWSAQRRRRHDSVALDHMVAVL 3 +SSK R + SE TLS CPSDLIA S FLWSAQ RRRHDS A D +V VL Sbjct: 23 SSSKWRRRNTVNSE----TLSRCPSDLIAFSLFLWSAQ-RRRHDSFAFDRIVTVL 72 >XP_006465137.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_006465138.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_006465139.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_015384676.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_015384678.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_015384682.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_015384686.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_015384687.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] XP_015384692.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] Length = 645 Score = 57.0 bits (136), Expect = 3e-07 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = -2 Query: 143 VVLKSESVHSTLSSCPSDLIALSFFLWSA-QRRRRHDSVALDHMVAVL 3 ++L + VHSTL +CPSDLIALSFF+W A QR HD + DHM++V+ Sbjct: 46 IILAPQIVHSTLLNCPSDLIALSFFIWCAKQRDYFHDVQSFDHMISVV 93 >XP_016197200.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Arachis ipaensis] XP_016197201.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Arachis ipaensis] XP_016197202.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Arachis ipaensis] XP_016197203.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Arachis ipaensis] XP_016197204.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Arachis ipaensis] XP_016197206.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Arachis ipaensis] XP_016197207.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Arachis ipaensis] Length = 690 Score = 56.6 bits (135), Expect = 5e-07 Identities = 31/66 (46%), Positives = 43/66 (65%), Gaps = 10/66 (15%) Frame = -2 Query: 170 RTSSKRRSEVVL-KSESVHSTLSSCPSDLIALSFFLWSAQRRR---------RHDSVALD 21 +T +K + E V+ + + VHST++ CPSDLI LSFF+W+AQR+ HD ALD Sbjct: 64 KTKTKTKMESVMSRIDVVHSTVARCPSDLITLSFFIWTAQRQNYYNDFNYNYSHDIRALD 123 Query: 20 HMVAVL 3 +MV VL Sbjct: 124 YMVPVL 129 >KDO46846.1 hypothetical protein CISIN_1g006437mg [Citrus sinensis] Length = 645 Score = 56.2 bits (134), Expect = 6e-07 Identities = 27/48 (56%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = -2 Query: 143 VVLKSESVHSTLSSCPSDLIALSFFLWSA-QRRRRHDSVALDHMVAVL 3 ++L VHSTL +CPSDLIALSFF+W A QR HD + DHM++V+ Sbjct: 46 IILAPHIVHSTLLNCPSDLIALSFFIWCAKQRDYFHDVQSFDHMISVV 93 >XP_015958855.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Arachis duranensis] XP_015958856.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Arachis duranensis] XP_015958857.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Arachis duranensis] XP_015958858.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Arachis duranensis] XP_015958859.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Arachis duranensis] XP_015958860.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Arachis duranensis] XP_015958861.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Arachis duranensis] Length = 690 Score = 56.2 bits (134), Expect = 6e-07 Identities = 30/66 (45%), Positives = 44/66 (66%), Gaps = 10/66 (15%) Frame = -2 Query: 170 RTSSKRRSEVVL-KSESVHSTLSSCPSDLIALSFFLWSAQRRR---------RHDSVALD 21 +T +K + E+V+ + + VHST++ CPSDLI LSFF+W+A+R+ HD ALD Sbjct: 64 KTKTKTKMELVMSRIDVVHSTVARCPSDLITLSFFIWTARRQNYYNDFNYNYSHDIRALD 123 Query: 20 HMVAVL 3 +MV VL Sbjct: 124 YMVPVL 129 >XP_008342596.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] XP_008342597.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] XP_008342599.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] XP_008342600.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] XP_008342601.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] XP_008342602.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] XP_017179782.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] XP_017179783.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] XP_017179784.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] XP_017179786.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] XP_017179787.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] Length = 661 Score = 55.8 bits (133), Expect = 8e-07 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = -2 Query: 176 FPRTSSKRRSEVVLKSESVHSTLSSCPSDLIALSFFLWSA-QRRRRHDSVALDHMVAVL 3 FP+ ++ S+ L + VHSTL +CPSDLIAL FFLW A Q H + +DHMV V+ Sbjct: 46 FPKLFDRQTSK--LNHQVVHSTLLNCPSDLIALRFFLWCAGQHNFFHSKIVIDHMVGVI 102