BLASTX nr result
ID: Glycyrrhiza33_contig00017784
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00017784 (370 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN14700.1 E3 ubiquitin protein ligase DRIP2 [Glycine soja] 76 8e-15 XP_015939921.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 79 1e-14 XP_016176516.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 79 1e-14 XP_016176515.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 79 1e-14 XP_015939920.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 79 1e-14 XP_019428760.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 78 1e-14 XP_019428758.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 78 2e-14 KHN18060.1 E3 ubiquitin protein ligase DRIP2 [Glycine soja] 78 2e-14 XP_006589184.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 78 2e-14 XP_014514668.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 78 2e-14 KRG92688.1 hypothetical protein GLYMA_20G225400 [Glycine max] 78 2e-14 XP_017440191.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 78 2e-14 XP_014514667.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 78 2e-14 XP_003556472.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 78 2e-14 XP_007144831.1 hypothetical protein PHAVU_007G187800g [Phaseolus... 77 3e-14 XP_010326435.1 PREDICTED: E3 ubiquitin protein ligase DRIP2 isof... 77 4e-14 XP_015086549.1 PREDICTED: E3 ubiquitin protein ligase DRIP2 [Sol... 77 4e-14 XP_004247220.1 PREDICTED: E3 ubiquitin protein ligase DRIP2 isof... 77 4e-14 KYP74478.1 Polycomb group RING finger protein 1 [Cajanus cajan] 77 6e-14 XP_019453410.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 76 1e-13 >KHN14700.1 E3 ubiquitin protein ligase DRIP2 [Glycine soja] Length = 172 Score = 75.9 bits (185), Expect = 8e-15 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -3 Query: 113 DTIRACMTCPLCHNLFRDATTISLCLHSFCRKCIYEK 3 +T+R CMTCPLCH F+DATTISLCLH+FCRKCIYEK Sbjct: 13 NTLRPCMTCPLCHKFFKDATTISLCLHTFCRKCIYEK 49 >XP_015939921.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X2 [Arachis duranensis] Length = 374 Score = 78.6 bits (192), Expect = 1e-14 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 113 DTIRACMTCPLCHNLFRDATTISLCLHSFCRKCIYEK 3 DT+RACMTCPLC+NL +DATTISLCLH+FCRKCIYEK Sbjct: 14 DTLRACMTCPLCNNLLKDATTISLCLHTFCRKCIYEK 50 >XP_016176516.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X2 [Arachis ipaensis] Length = 387 Score = 78.6 bits (192), Expect = 1e-14 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 113 DTIRACMTCPLCHNLFRDATTISLCLHSFCRKCIYEK 3 DT+RACMTCPLC+NL +DATTISLCLH+FCRKCIYEK Sbjct: 14 DTLRACMTCPLCNNLLKDATTISLCLHTFCRKCIYEK 50 >XP_016176515.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X1 [Arachis ipaensis] Length = 434 Score = 78.6 bits (192), Expect = 1e-14 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 113 DTIRACMTCPLCHNLFRDATTISLCLHSFCRKCIYEK 3 DT+RACMTCPLC+NL +DATTISLCLH+FCRKCIYEK Sbjct: 14 DTLRACMTCPLCNNLLKDATTISLCLHTFCRKCIYEK 50 >XP_015939920.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X1 [Arachis duranensis] Length = 434 Score = 78.6 bits (192), Expect = 1e-14 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 113 DTIRACMTCPLCHNLFRDATTISLCLHSFCRKCIYEK 3 DT+RACMTCPLC+NL +DATTISLCLH+FCRKCIYEK Sbjct: 14 DTLRACMTCPLCNNLLKDATTISLCLHTFCRKCIYEK 50 >XP_019428760.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X3 [Lupinus angustifolius] Length = 380 Score = 78.2 bits (191), Expect = 1e-14 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 113 DTIRACMTCPLCHNLFRDATTISLCLHSFCRKCIYEK 3 DT+RACMTCPLCHNLF+ TTISLCLH+FCRKCIYEK Sbjct: 12 DTLRACMTCPLCHNLFKYPTTISLCLHTFCRKCIYEK 48 >XP_019428758.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X1 [Lupinus angustifolius] Length = 431 Score = 78.2 bits (191), Expect = 2e-14 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 113 DTIRACMTCPLCHNLFRDATTISLCLHSFCRKCIYEK 3 DT+RACMTCPLCHNLF+ TTISLCLH+FCRKCIYEK Sbjct: 12 DTLRACMTCPLCHNLFKYPTTISLCLHTFCRKCIYEK 48 >KHN18060.1 E3 ubiquitin protein ligase DRIP2 [Glycine soja] Length = 432 Score = 78.2 bits (191), Expect = 2e-14 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 113 DTIRACMTCPLCHNLFRDATTISLCLHSFCRKCIYEK 3 DT+R CMTCPLCHN F+DATTIS CLH+FCRKCIYEK Sbjct: 12 DTLRPCMTCPLCHNFFKDATTISTCLHTFCRKCIYEK 48 >XP_006589184.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X2 [Glycine max] KRH34095.1 hypothetical protein GLYMA_10G162800 [Glycine max] Length = 432 Score = 78.2 bits (191), Expect = 2e-14 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 113 DTIRACMTCPLCHNLFRDATTISLCLHSFCRKCIYEK 3 DT+R CMTCPLCHN F+DATTIS CLH+FCRKCIYEK Sbjct: 12 DTLRPCMTCPLCHNFFKDATTISTCLHTFCRKCIYEK 48 >XP_014514668.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X2 [Vigna radiata var. radiata] Length = 395 Score = 77.8 bits (190), Expect = 2e-14 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -3 Query: 113 DTIRACMTCPLCHNLFRDATTISLCLHSFCRKCIYEK 3 DT+R CMTCPLCHN ++DATTISLCLH+FCRKCIY+K Sbjct: 12 DTLRPCMTCPLCHNFYKDATTISLCLHTFCRKCIYDK 48 >KRG92688.1 hypothetical protein GLYMA_20G225400 [Glycine max] Length = 416 Score = 77.8 bits (190), Expect = 2e-14 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 113 DTIRACMTCPLCHNLFRDATTISLCLHSFCRKCIYEK 3 DT+R CMTCPLCH F+DATTISLCLH+FCRKCIYEK Sbjct: 13 DTLRPCMTCPLCHKFFKDATTISLCLHTFCRKCIYEK 49 >XP_017440191.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Vigna angularis] BAT94966.1 hypothetical protein VIGAN_08161800 [Vigna angularis var. angularis] Length = 432 Score = 77.8 bits (190), Expect = 2e-14 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -3 Query: 113 DTIRACMTCPLCHNLFRDATTISLCLHSFCRKCIYEK 3 DT+R CMTCPLCHN ++DATTISLCLH+FCRKCIY+K Sbjct: 12 DTLRPCMTCPLCHNFYKDATTISLCLHTFCRKCIYDK 48 >XP_014514667.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X1 [Vigna radiata var. radiata] Length = 433 Score = 77.8 bits (190), Expect = 2e-14 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -3 Query: 113 DTIRACMTCPLCHNLFRDATTISLCLHSFCRKCIYEK 3 DT+R CMTCPLCHN ++DATTISLCLH+FCRKCIY+K Sbjct: 12 DTLRPCMTCPLCHNFYKDATTISLCLHTFCRKCIYDK 48 >XP_003556472.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Glycine max] KRG92687.1 hypothetical protein GLYMA_20G225400 [Glycine max] Length = 433 Score = 77.8 bits (190), Expect = 2e-14 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 113 DTIRACMTCPLCHNLFRDATTISLCLHSFCRKCIYEK 3 DT+R CMTCPLCH F+DATTISLCLH+FCRKCIYEK Sbjct: 13 DTLRPCMTCPLCHKFFKDATTISLCLHTFCRKCIYEK 49 >XP_007144831.1 hypothetical protein PHAVU_007G187800g [Phaseolus vulgaris] ESW16825.1 hypothetical protein PHAVU_007G187800g [Phaseolus vulgaris] Length = 432 Score = 77.4 bits (189), Expect = 3e-14 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = -3 Query: 113 DTIRACMTCPLCHNLFRDATTISLCLHSFCRKCIYEK 3 +T+R CMTCPLCHNL++DATTISLCLH+FCRKCIY+K Sbjct: 12 NTLRPCMTCPLCHNLYKDATTISLCLHTFCRKCIYDK 48 >XP_010326435.1 PREDICTED: E3 ubiquitin protein ligase DRIP2 isoform X2 [Solanum lycopersicum] Length = 395 Score = 77.0 bits (188), Expect = 4e-14 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 113 DTIRACMTCPLCHNLFRDATTISLCLHSFCRKCIYEK 3 D I ACMTCPLCHNLFRDATTIS CLH+FCRKCIY+K Sbjct: 11 DVIAACMTCPLCHNLFRDATTISECLHTFCRKCIYKK 47 >XP_015086549.1 PREDICTED: E3 ubiquitin protein ligase DRIP2 [Solanum pennellii] Length = 430 Score = 77.0 bits (188), Expect = 4e-14 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 113 DTIRACMTCPLCHNLFRDATTISLCLHSFCRKCIYEK 3 D I ACMTCPLCHNLFRDATTIS CLH+FCRKCIY+K Sbjct: 11 DVIAACMTCPLCHNLFRDATTISECLHTFCRKCIYKK 47 >XP_004247220.1 PREDICTED: E3 ubiquitin protein ligase DRIP2 isoform X1 [Solanum lycopersicum] Length = 430 Score = 77.0 bits (188), Expect = 4e-14 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 113 DTIRACMTCPLCHNLFRDATTISLCLHSFCRKCIYEK 3 D I ACMTCPLCHNLFRDATTIS CLH+FCRKCIY+K Sbjct: 11 DVIAACMTCPLCHNLFRDATTISECLHTFCRKCIYKK 47 >KYP74478.1 Polycomb group RING finger protein 1 [Cajanus cajan] Length = 431 Score = 76.6 bits (187), Expect = 6e-14 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 113 DTIRACMTCPLCHNLFRDATTISLCLHSFCRKCIYEK 3 +T+R CMTCPLCH L RDATTISLCLH+FCRKCIYEK Sbjct: 12 ETLRTCMTCPLCHKLVRDATTISLCLHTFCRKCIYEK 48 >XP_019453410.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X1 [Lupinus angustifolius] Length = 431 Score = 75.9 bits (185), Expect = 1e-13 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 113 DTIRACMTCPLCHNLFRDATTISLCLHSFCRKCIYEK 3 DT+RACMTCPLCH LF+ TTISLCLH+FCRKCIYEK Sbjct: 12 DTLRACMTCPLCHKLFKYPTTISLCLHTFCRKCIYEK 48