BLASTX nr result
ID: Glycyrrhiza33_contig00017079
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00017079 (395 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW12309.1 hypothetical protein TanjilG_06098 [Lupinus angustifo... 58 4e-08 XP_019437060.1 PREDICTED: uncharacterized protein LOC109343291 [... 55 8e-07 XP_003554126.1 PREDICTED: uncharacterized protein LOC100808231 [... 55 1e-06 KHN08877.1 hypothetical protein glysoja_029454 [Glycine soja] 55 1e-06 XP_006576783.1 PREDICTED: sigma factor binding protein 1, chloro... 54 3e-06 >OIW12309.1 hypothetical protein TanjilG_06098 [Lupinus angustifolius] Length = 132 Score = 57.8 bits (138), Expect = 4e-08 Identities = 35/60 (58%), Positives = 37/60 (61%), Gaps = 6/60 (10%) Frame = -2 Query: 166 VVYISNPMKX----AGFRALVQELTGRDAESPPDPSMY--XXXXXGVHETVDDEDCVKRN 5 VVYISNPMK + FR LVQELTG+DAE PDPS Y G V DEDCVK N Sbjct: 10 VVYISNPMKVKTSVSEFRTLVQELTGKDAEMQPDPSRYCWEGDSSGYKILVSDEDCVKEN 69 >XP_019437060.1 PREDICTED: uncharacterized protein LOC109343291 [Lupinus angustifolius] OIW15476.1 hypothetical protein TanjilG_32880 [Lupinus angustifolius] Length = 146 Score = 54.7 bits (130), Expect = 8e-07 Identities = 28/38 (73%), Positives = 31/38 (81%), Gaps = 4/38 (10%) Frame = -2 Query: 166 VVYISNPMKX----AGFRALVQELTGRDAESPPDPSMY 65 VVYISNPMK + FRALVQELTG+DAESPPDPS + Sbjct: 36 VVYISNPMKVKTSASKFRALVQELTGQDAESPPDPSRF 73 >XP_003554126.1 PREDICTED: uncharacterized protein LOC100808231 [Glycine max] KRG95105.1 hypothetical protein GLYMA_19G130400 [Glycine max] Length = 168 Score = 54.7 bits (130), Expect = 1e-06 Identities = 28/38 (73%), Positives = 31/38 (81%), Gaps = 4/38 (10%) Frame = -2 Query: 166 VVYISNPMKX----AGFRALVQELTGRDAESPPDPSMY 65 VVYISNPMK + FRALVQELTG+DAESPPDPS + Sbjct: 34 VVYISNPMKIKTSASEFRALVQELTGQDAESPPDPSRF 71 >KHN08877.1 hypothetical protein glysoja_029454 [Glycine soja] Length = 171 Score = 54.7 bits (130), Expect = 1e-06 Identities = 28/38 (73%), Positives = 31/38 (81%), Gaps = 4/38 (10%) Frame = -2 Query: 166 VVYISNPMKX----AGFRALVQELTGRDAESPPDPSMY 65 VVYISNPMK + FRALVQELTG+DAESPPDPS + Sbjct: 34 VVYISNPMKIKTSASEFRALVQELTGQDAESPPDPSRF 71 >XP_006576783.1 PREDICTED: sigma factor binding protein 1, chloroplastic-like [Glycine max] KHN30364.1 hypothetical protein glysoja_025855 [Glycine soja] KRH66773.1 hypothetical protein GLYMA_03G127800 [Glycine max] Length = 167 Score = 53.5 bits (127), Expect = 3e-06 Identities = 27/38 (71%), Positives = 31/38 (81%), Gaps = 4/38 (10%) Frame = -2 Query: 166 VVYISNPMKX----AGFRALVQELTGRDAESPPDPSMY 65 VVYISNPMK + FRALVQELTG+DAESPPDP+ + Sbjct: 34 VVYISNPMKIKTSASEFRALVQELTGQDAESPPDPTRF 71