BLASTX nr result
ID: Glycyrrhiza33_contig00016976
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00016976 (449 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017235000.1 PREDICTED: calcium-dependent protein kinase 3-lik... 69 6e-11 XP_018829273.1 PREDICTED: calcium-dependent protein kinase 1-lik... 68 1e-10 XP_018837191.1 PREDICTED: calcium-dependent protein kinase 1-lik... 68 2e-10 KHN25667.1 Calcium-dependent protein kinase 3 [Glycine soja] 65 1e-09 KRH77599.1 hypothetical protein GLYMA_01G223200 [Glycine max] 65 1e-09 XP_015896537.1 PREDICTED: calcium-dependent protein kinase 3 [Zi... 65 1e-09 XP_003517491.3 PREDICTED: calcium-dependent protein kinase 3-lik... 65 1e-09 XP_012086799.1 PREDICTED: calcium-dependent protein kinase 3 [Ja... 65 2e-09 OAY56422.1 hypothetical protein MANES_02G015100 [Manihot esculenta] 65 2e-09 KHN35055.1 Calcium-dependent protein kinase 3 [Glycine soja] 64 4e-09 XP_003538256.1 PREDICTED: calcium-dependent protein kinase 3 [Gl... 64 4e-09 KZV44984.1 calcium-dependent protein kinase 3 [Dorcoceras hygrom... 64 4e-09 XP_019151661.1 PREDICTED: calcium-dependent protein kinase 1-lik... 63 8e-09 XP_003611046.1 calmodulin-domain kinase CDPK protein [Medicago t... 63 8e-09 XP_004298849.1 PREDICTED: calcium-dependent protein kinase 3 [Fr... 63 1e-08 XP_010251583.1 PREDICTED: calcium-dependent protein kinase 1-lik... 63 1e-08 XP_002509886.1 PREDICTED: calcium-dependent protein kinase 3 [Ri... 63 1e-08 XP_007040387.2 PREDICTED: calcium-dependent protein kinase 3 [Th... 63 1e-08 EOY24888.1 Calcium-dependent protein kinase 6 isoform 1 [Theobro... 63 1e-08 KYP37630.1 Calcium-dependent protein kinase 3 [Cajanus cajan] 61 1e-08 >XP_017235000.1 PREDICTED: calcium-dependent protein kinase 3-like [Daucus carota subsp. sativus] KZN06014.1 hypothetical protein DCAR_006851 [Daucus carota subsp. sativus] Length = 521 Score = 69.3 bits (168), Expect = 6e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 VDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 98 VDTDNDGRINYDEFVDMMRKGNP+LVTNRRRK Sbjct: 490 VDTDNDGRINYDEFVDMMRKGNPELVTNRRRK 521 >XP_018829273.1 PREDICTED: calcium-dependent protein kinase 1-like [Juglans regia] Length = 515 Score = 68.2 bits (165), Expect = 1e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 3 VDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 98 VDTDNDGRINYDEFV MMRKGNPDLVTNRRRK Sbjct: 484 VDTDNDGRINYDEFVTMMRKGNPDLVTNRRRK 515 >XP_018837191.1 PREDICTED: calcium-dependent protein kinase 1-like [Juglans regia] XP_018837192.1 PREDICTED: calcium-dependent protein kinase 1-like [Juglans regia] Length = 521 Score = 67.8 bits (164), Expect = 2e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 VDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 98 VDTDNDGRINYDEFV MMRKGNPDL+TNRRRK Sbjct: 490 VDTDNDGRINYDEFVTMMRKGNPDLITNRRRK 521 >KHN25667.1 Calcium-dependent protein kinase 3 [Glycine soja] Length = 383 Score = 65.5 bits (158), Expect = 1e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +3 Query: 3 VDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 98 VDTDNDGRINYDEFV MMRKG PDLVTNRRRK Sbjct: 352 VDTDNDGRINYDEFVAMMRKGKPDLVTNRRRK 383 >KRH77599.1 hypothetical protein GLYMA_01G223200 [Glycine max] Length = 528 Score = 65.5 bits (158), Expect = 1e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +3 Query: 3 VDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 98 VDTDNDGRINYDEFV MMRKG PDLVTNRRRK Sbjct: 497 VDTDNDGRINYDEFVAMMRKGKPDLVTNRRRK 528 >XP_015896537.1 PREDICTED: calcium-dependent protein kinase 3 [Ziziphus jujuba] Length = 531 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 3 VDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 98 VDTDNDGRINYDEFV MMRKGNPD+ TNRRRK Sbjct: 500 VDTDNDGRINYDEFVAMMRKGNPDMATNRRRK 531 >XP_003517491.3 PREDICTED: calcium-dependent protein kinase 3-like [Glycine max] Length = 542 Score = 65.5 bits (158), Expect = 1e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +3 Query: 3 VDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 98 VDTDNDGRINYDEFV MMRKG PDLVTNRRRK Sbjct: 511 VDTDNDGRINYDEFVAMMRKGKPDLVTNRRRK 542 >XP_012086799.1 PREDICTED: calcium-dependent protein kinase 3 [Jatropha curcas] KDP25359.1 hypothetical protein JCGZ_20515 [Jatropha curcas] Length = 525 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 VDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 98 VDTDNDG+INY+EFV MMRKGNPDLVTNRRRK Sbjct: 494 VDTDNDGKINYEEFVAMMRKGNPDLVTNRRRK 525 >OAY56422.1 hypothetical protein MANES_02G015100 [Manihot esculenta] Length = 459 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 VDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 98 VDTDNDGRINY+EFV MMRKGNP+LVTNRRRK Sbjct: 428 VDTDNDGRINYEEFVAMMRKGNPELVTNRRRK 459 >KHN35055.1 Calcium-dependent protein kinase 3 [Glycine soja] Length = 373 Score = 63.9 bits (154), Expect = 4e-09 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 VDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 98 VD DNDGRINYDEFV MMRKGNPDLV NRRRK Sbjct: 342 VDADNDGRINYDEFVAMMRKGNPDLVNNRRRK 373 >XP_003538256.1 PREDICTED: calcium-dependent protein kinase 3 [Glycine max] KRH27875.1 hypothetical protein GLYMA_11G020200 [Glycine max] Length = 505 Score = 63.9 bits (154), Expect = 4e-09 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 VDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 98 VD DNDGRINYDEFV MMRKGNPDLV NRRRK Sbjct: 474 VDADNDGRINYDEFVAMMRKGNPDLVNNRRRK 505 >KZV44984.1 calcium-dependent protein kinase 3 [Dorcoceras hygrometricum] Length = 519 Score = 63.9 bits (154), Expect = 4e-09 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 VDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 98 VDTDNDGRINYDEF MMRKGNPDLV NRRRK Sbjct: 488 VDTDNDGRINYDEFAAMMRKGNPDLVINRRRK 519 >XP_019151661.1 PREDICTED: calcium-dependent protein kinase 1-like [Ipomoea nil] Length = 514 Score = 63.2 bits (152), Expect = 8e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 3 VDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 98 VDTDNDG+INYDEFV MMRKG PDLVTNRRR+ Sbjct: 483 VDTDNDGKINYDEFVAMMRKGTPDLVTNRRRR 514 >XP_003611046.1 calmodulin-domain kinase CDPK protein [Medicago truncatula] AES94004.1 calmodulin-domain kinase CDPK protein [Medicago truncatula] Length = 517 Score = 63.2 bits (152), Expect = 8e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 3 VDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 98 VD+DNDGRINY+EFV MMRKGNPDL+TN+RRK Sbjct: 486 VDSDNDGRINYEEFVAMMRKGNPDLITNKRRK 517 >XP_004298849.1 PREDICTED: calcium-dependent protein kinase 3 [Fragaria vesca subsp. vesca] Length = 519 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 3 VDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 98 VDTD DGRINYDEFV MMRKGNP+LVTNRRRK Sbjct: 488 VDTDLDGRINYDEFVAMMRKGNPELVTNRRRK 519 >XP_010251583.1 PREDICTED: calcium-dependent protein kinase 1-like [Nelumbo nucifera] Length = 522 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 3 VDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 98 VDTD+DGRINYDEFV MMRKGNP+L TNRRRK Sbjct: 491 VDTDHDGRINYDEFVAMMRKGNPELTTNRRRK 522 >XP_002509886.1 PREDICTED: calcium-dependent protein kinase 3 [Ricinus communis] EEF51273.1 calcium-dependent protein kinase, putative [Ricinus communis] Length = 528 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 VDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 98 VDTD+DGRINY+EFV MMRKGNP+LVTNRRRK Sbjct: 497 VDTDHDGRINYEEFVAMMRKGNPELVTNRRRK 528 >XP_007040387.2 PREDICTED: calcium-dependent protein kinase 3 [Theobroma cacao] Length = 531 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 VDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 98 VDTD DGRINYDEFV MMRKGNPDLV NRRRK Sbjct: 500 VDTDRDGRINYDEFVAMMRKGNPDLVGNRRRK 531 >EOY24888.1 Calcium-dependent protein kinase 6 isoform 1 [Theobroma cacao] Length = 531 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 VDTDNDGRINYDEFVDMMRKGNPDLVTNRRRK 98 VDTD DGRINYDEFV MMRKGNPDLV NRRRK Sbjct: 500 VDTDRDGRINYDEFVAMMRKGNPDLVGNRRRK 531 >KYP37630.1 Calcium-dependent protein kinase 3 [Cajanus cajan] Length = 201 Score = 61.2 bits (147), Expect = 1e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 3 VDTDNDGRINYDEFVDMMRKGNPDLVTNRRR 95 VDTDNDGRINYDEFVDMM+KGNPDL + RR+ Sbjct: 171 VDTDNDGRINYDEFVDMMKKGNPDLASRRRK 201