BLASTX nr result
ID: Glycyrrhiza33_contig00016883
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00016883 (397 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017410735.1 PREDICTED: putative leucine-rich repeat-containin... 78 4e-14 XP_014508981.1 PREDICTED: putative leucine-rich repeat-containin... 77 1e-13 XP_014508979.1 PREDICTED: myosin-3 isoform X1 [Vigna radiata var... 77 1e-13 XP_012572146.1 PREDICTED: centromere-associated protein E isofor... 73 2e-12 KHN16755.1 hypothetical protein glysoja_002852 [Glycine soja] 73 2e-12 XP_006584753.1 PREDICTED: myosin heavy chain, cardiac muscle iso... 73 2e-12 XP_012572145.1 PREDICTED: centromere-associated protein E isofor... 73 2e-12 XP_012572143.1 PREDICTED: centromere-associated protein E isofor... 73 2e-12 KYP58683.1 Laminin subunit alpha-2 [Cajanus cajan] 73 2e-12 XP_019422100.1 PREDICTED: intracellular protein transport protei... 72 3e-12 OIV94020.1 hypothetical protein TanjilG_19381 [Lupinus angustifo... 72 3e-12 XP_016189418.1 PREDICTED: myosin heavy chain, skeletal muscle, a... 72 6e-12 XP_015955369.1 PREDICTED: intracellular protein transport protei... 72 6e-12 XP_006580538.1 PREDICTED: myosin-9 [Glycine max] KHM99917.1 hypo... 71 1e-11 XP_007160143.1 hypothetical protein PHAVU_002G296300g [Phaseolus... 70 1e-11 XP_013447167.1 COP1-interactive protein, putative [Medicago trun... 70 3e-11 XP_019446538.1 PREDICTED: myosin-11-like [Lupinus angustifolius] 67 2e-10 OIW09929.1 hypothetical protein TanjilG_32078 [Lupinus angustifo... 67 2e-10 XP_011022541.1 PREDICTED: myosin-10-like [Populus euphratica] XP... 66 6e-10 XP_002303631.2 hypothetical protein POPTR_0003s13720g [Populus t... 66 6e-10 >XP_017410735.1 PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 [Vigna angularis] XP_017410736.1 PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 [Vigna angularis] XP_017410737.1 PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 [Vigna angularis] KOM29877.1 hypothetical protein LR48_Vigan818s007500 [Vigna angularis] BAT73001.1 hypothetical protein VIGAN_01045100 [Vigna angularis var. angularis] Length = 1309 Score = 77.8 bits (190), Expect = 4e-14 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = +2 Query: 2 LDLGEEKREAIRQLCLWIDYHRNRYDSLRDMIISKTRSGQRAA 130 LDLGEEKRE IRQLCLWIDYHR+RYD LRD I+SKTRSGQRAA Sbjct: 1268 LDLGEEKREVIRQLCLWIDYHRSRYDYLRD-ILSKTRSGQRAA 1309 >XP_014508981.1 PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 isoform X2 [Vigna radiata var. radiata] Length = 1235 Score = 76.6 bits (187), Expect = 1e-13 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +2 Query: 2 LDLGEEKREAIRQLCLWIDYHRNRYDSLRDMIISKTRSGQRAA 130 LDLGEEKRE IRQLCLWIDYHR+RYD L+D I+SKTRSGQRAA Sbjct: 1194 LDLGEEKREVIRQLCLWIDYHRSRYDYLKD-ILSKTRSGQRAA 1235 >XP_014508979.1 PREDICTED: myosin-3 isoform X1 [Vigna radiata var. radiata] XP_014508980.1 PREDICTED: myosin-3 isoform X1 [Vigna radiata var. radiata] Length = 1337 Score = 76.6 bits (187), Expect = 1e-13 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +2 Query: 2 LDLGEEKREAIRQLCLWIDYHRNRYDSLRDMIISKTRSGQRAA 130 LDLGEEKRE IRQLCLWIDYHR+RYD L+D I+SKTRSGQRAA Sbjct: 1296 LDLGEEKREVIRQLCLWIDYHRSRYDYLKD-ILSKTRSGQRAA 1337 >XP_012572146.1 PREDICTED: centromere-associated protein E isoform X4 [Cicer arietinum] Length = 1375 Score = 73.2 bits (178), Expect = 2e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +2 Query: 2 LDLGEEKREAIRQLCLWIDYHRNRYDSLRDMIISKTRSGQRA 127 LDLGEEKREAI+QLC+WIDYHR RYD L+D IISKTR GQRA Sbjct: 1334 LDLGEEKREAIKQLCIWIDYHRERYDYLKD-IISKTRRGQRA 1374 >KHN16755.1 hypothetical protein glysoja_002852 [Glycine soja] Length = 1405 Score = 73.2 bits (178), Expect = 2e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +2 Query: 2 LDLGEEKREAIRQLCLWIDYHRNRYDSLRDMIISKTRSGQRAA 130 LDLGEEKRE IRQLCLWIDYHR+RYD L+D I+SK+R GQRAA Sbjct: 1364 LDLGEEKREVIRQLCLWIDYHRSRYDYLKD-ILSKSRRGQRAA 1405 >XP_006584753.1 PREDICTED: myosin heavy chain, cardiac muscle isoform [Glycine max] XP_006584755.1 PREDICTED: myosin heavy chain, cardiac muscle isoform [Glycine max] KRH41293.1 hypothetical protein GLYMA_08G021400 [Glycine max] Length = 1411 Score = 73.2 bits (178), Expect = 2e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +2 Query: 2 LDLGEEKREAIRQLCLWIDYHRNRYDSLRDMIISKTRSGQRAA 130 LDLGEEKRE IRQLCLWIDYHR+RYD L+D I+SK+R GQRAA Sbjct: 1370 LDLGEEKREVIRQLCLWIDYHRSRYDYLKD-ILSKSRRGQRAA 1411 >XP_012572145.1 PREDICTED: centromere-associated protein E isoform X3 [Cicer arietinum] Length = 1440 Score = 73.2 bits (178), Expect = 2e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +2 Query: 2 LDLGEEKREAIRQLCLWIDYHRNRYDSLRDMIISKTRSGQRA 127 LDLGEEKREAI+QLC+WIDYHR RYD L+D IISKTR GQRA Sbjct: 1399 LDLGEEKREAIKQLCIWIDYHRERYDYLKD-IISKTRRGQRA 1439 >XP_012572143.1 PREDICTED: centromere-associated protein E isoform X1 [Cicer arietinum] Length = 1484 Score = 73.2 bits (178), Expect = 2e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +2 Query: 2 LDLGEEKREAIRQLCLWIDYHRNRYDSLRDMIISKTRSGQRA 127 LDLGEEKREAI+QLC+WIDYHR RYD L+D IISKTR GQRA Sbjct: 1443 LDLGEEKREAIKQLCIWIDYHRERYDYLKD-IISKTRRGQRA 1483 >KYP58683.1 Laminin subunit alpha-2 [Cajanus cajan] Length = 705 Score = 72.8 bits (177), Expect = 2e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +2 Query: 2 LDLGEEKREAIRQLCLWIDYHRNRYDSLRDMIISKTRSGQRAA 130 LDLGEEKRE IRQLCLWIDYHR+RYD L+D+++ KTR GQRAA Sbjct: 664 LDLGEEKREVIRQLCLWIDYHRSRYDYLKDILL-KTRRGQRAA 705 >XP_019422100.1 PREDICTED: intracellular protein transport protein USO1-like [Lupinus angustifolius] XP_019422101.1 PREDICTED: intracellular protein transport protein USO1-like [Lupinus angustifolius] Length = 1061 Score = 72.4 bits (176), Expect = 3e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +2 Query: 2 LDLGEEKREAIRQLCLWIDYHRNRYDSLRDMIISKTRSGQRA 127 LDLGEEKREAIRQLCLWI+YHR RYD L+D I+SKTR GQRA Sbjct: 1020 LDLGEEKREAIRQLCLWIEYHRGRYDYLKD-ILSKTRIGQRA 1060 >OIV94020.1 hypothetical protein TanjilG_19381 [Lupinus angustifolius] Length = 1121 Score = 72.4 bits (176), Expect = 3e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +2 Query: 2 LDLGEEKREAIRQLCLWIDYHRNRYDSLRDMIISKTRSGQRA 127 LDLGEEKREAIRQLCLWI+YHR RYD L+D I+SKTR GQRA Sbjct: 1080 LDLGEEKREAIRQLCLWIEYHRGRYDYLKD-ILSKTRIGQRA 1120 >XP_016189418.1 PREDICTED: myosin heavy chain, skeletal muscle, adult [Arachis ipaensis] XP_016189419.1 PREDICTED: myosin heavy chain, skeletal muscle, adult [Arachis ipaensis] Length = 1275 Score = 71.6 bits (174), Expect = 6e-12 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +2 Query: 2 LDLGEEKREAIRQLCLWIDYHRNRYDSLRDMIISKTRSGQRAA 130 LDLGEEKREAIRQLCLWIDYHR+RYD L+D ++SKT GQR A Sbjct: 1234 LDLGEEKREAIRQLCLWIDYHRSRYDYLKD-VLSKTGRGQRTA 1275 >XP_015955369.1 PREDICTED: intracellular protein transport protein USO1 [Arachis duranensis] XP_015955370.1 PREDICTED: intracellular protein transport protein USO1 [Arachis duranensis] XP_015955371.1 PREDICTED: intracellular protein transport protein USO1 [Arachis duranensis] Length = 1275 Score = 71.6 bits (174), Expect = 6e-12 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +2 Query: 2 LDLGEEKREAIRQLCLWIDYHRNRYDSLRDMIISKTRSGQRAA 130 LDLGEEKREAIRQLCLWIDYHR+RYD L+D ++SKT GQR A Sbjct: 1234 LDLGEEKREAIRQLCLWIDYHRSRYDYLKD-VLSKTGRGQRTA 1275 >XP_006580538.1 PREDICTED: myosin-9 [Glycine max] KHM99917.1 hypothetical protein glysoja_017615 [Glycine soja] KRH60017.1 hypothetical protein GLYMA_05G215100 [Glycine max] KRH60018.1 hypothetical protein GLYMA_05G215100 [Glycine max] Length = 1207 Score = 70.9 bits (172), Expect = 1e-11 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +2 Query: 2 LDLGEEKREAIRQLCLWIDYHRNRYDSLRDMIISKTRSGQRAA 130 LDLGEEKRE IRQLCLWIDYHR+RYD L+D I+SK+R GQ AA Sbjct: 1166 LDLGEEKREVIRQLCLWIDYHRSRYDYLKD-ILSKSRRGQSAA 1207 >XP_007160143.1 hypothetical protein PHAVU_002G296300g [Phaseolus vulgaris] ESW32137.1 hypothetical protein PHAVU_002G296300g [Phaseolus vulgaris] Length = 1398 Score = 70.5 bits (171), Expect = 1e-11 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +2 Query: 2 LDLGEEKREAIRQLCLWIDYHRNRYDSLRDMIISKTRSGQRAA 130 LDLGEEKRE IRQLCLWIDYHR+RYD L+D ++S TR GQR A Sbjct: 1357 LDLGEEKREVIRQLCLWIDYHRSRYDYLKD-VLSNTRRGQRPA 1398 >XP_013447167.1 COP1-interactive protein, putative [Medicago truncatula] KEH21194.1 COP1-interactive protein, putative [Medicago truncatula] Length = 1223 Score = 69.7 bits (169), Expect = 3e-11 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = +2 Query: 2 LDLGEEKREAIRQLCLWIDYHRNRYDSLRDMIISKTRSGQRAA 130 LDLGEEKREAIRQLCLWIDYHR D L++ IISKTR GQRAA Sbjct: 1182 LDLGEEKREAIRQLCLWIDYHRESSDRLKE-IISKTRRGQRAA 1223 >XP_019446538.1 PREDICTED: myosin-11-like [Lupinus angustifolius] Length = 1609 Score = 67.0 bits (162), Expect = 2e-10 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = +2 Query: 5 DLGEEKREAIRQLCLWIDYHRNRYDSLRDMIISKTRSGQRAA 130 DL EEKREAIRQLCLW DYH RYD L+D I+SKTR+GQRAA Sbjct: 1569 DLVEEKREAIRQLCLWTDYHLGRYDYLKD-ILSKTRTGQRAA 1609 >OIW09929.1 hypothetical protein TanjilG_32078 [Lupinus angustifolius] Length = 1850 Score = 67.0 bits (162), Expect = 2e-10 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = +2 Query: 5 DLGEEKREAIRQLCLWIDYHRNRYDSLRDMIISKTRSGQRAA 130 DL EEKREAIRQLCLW DYH RYD L+D I+SKTR+GQRAA Sbjct: 1810 DLVEEKREAIRQLCLWTDYHLGRYDYLKD-ILSKTRTGQRAA 1850 >XP_011022541.1 PREDICTED: myosin-10-like [Populus euphratica] XP_011022542.1 PREDICTED: myosin-10-like [Populus euphratica] XP_011022543.1 PREDICTED: myosin-10-like [Populus euphratica] XP_011022544.1 PREDICTED: myosin-10-like [Populus euphratica] Length = 1277 Score = 65.9 bits (159), Expect = 6e-10 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +2 Query: 2 LDLGEEKREAIRQLCLWIDYHRNRYDSLRDMIISKTRSGQRAA 130 LDLGEEKREAIRQLC+WI+YH++RYD LR+M+ GQRA+ Sbjct: 1235 LDLGEEKREAIRQLCIWIEYHQSRYDYLREMLSKMPIRGQRAS 1277 >XP_002303631.2 hypothetical protein POPTR_0003s13720g [Populus trichocarpa] EEE78610.2 hypothetical protein POPTR_0003s13720g [Populus trichocarpa] Length = 1698 Score = 65.9 bits (159), Expect = 6e-10 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +2 Query: 2 LDLGEEKREAIRQLCLWIDYHRNRYDSLRDMIISKTRSGQRAA 130 LDLGEEKREAIRQLC+WI+YH++RYD LR+M+ GQRA+ Sbjct: 1656 LDLGEEKREAIRQLCIWIEYHQSRYDYLREMLSKMPIRGQRAS 1698