BLASTX nr result
ID: Glycyrrhiza33_contig00016545
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00016545 (472 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK49468.1 unknown [Medicago truncatula] 59 7e-08 XP_016191184.1 PREDICTED: DELLA protein GAIP-B-like [Arachis ipa... 60 9e-08 XP_015957883.1 PREDICTED: DELLA protein GAIP-B-like [Arachis dur... 60 9e-08 AGK07287.1 GAI1 [Rosa hybrid cultivar] 60 1e-07 AFK24645.1 PgDwarf8, partial [Cenchrus americanus] 60 1e-07 XP_015895446.1 PREDICTED: DELLA protein GAIP-B-like [Ziziphus ju... 60 2e-07 Q6EI06.1 RecName: Full=DELLA protein GAIP; AltName: Full=CmGAIP;... 60 2e-07 XP_008467128.1 PREDICTED: DELLA protein GAIP-B [Cucumis melo] 60 2e-07 XP_004150593.1 PREDICTED: DELLA protein GAIP-B [Cucumis sativus]... 60 2e-07 EEF34604.1 DELLA protein GAIP-B, putative [Ricinus communis] 60 2e-07 XP_015580029.1 PREDICTED: LOW QUALITY PROTEIN: DELLA protein GAI... 60 2e-07 XP_003531153.1 PREDICTED: DELLA protein GAI1-like [Glycine max] ... 59 3e-07 ABO61516.1 GAI1 [Glycine max] 59 3e-07 NP_001240948.1 DELLA protein GAI 1 [Glycine max] ACA24488.1 gibb... 59 3e-07 ABI34432.1 CRY [Pisum sativum] 59 3e-07 XP_004504565.1 PREDICTED: DELLA protein GAI1-like [Cicer arietinum] 59 3e-07 GAU44521.1 hypothetical protein TSUD_82270 [Trifolium subterraneum] 59 3e-07 XP_020104070.1 DELLA protein SLN1-like, partial [Ananas comosus] 59 3e-07 XP_007225630.1 hypothetical protein PRUPE_ppa005944mg [Prunus pe... 59 4e-07 XP_010101954.1 hypothetical protein L484_011971 [Morus notabilis... 59 4e-07 >AFK49468.1 unknown [Medicago truncatula] Length = 180 Score = 58.9 bits (141), Expect = 7e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -3 Query: 458 SVIVNSVFELHRLLIHPGALDKVISVVRQIRPKIVTVV 345 SV VNSVFELH+L PGAL+KV SV+RQIRP+IVTVV Sbjct: 81 SVAVNSVFELHKLNARPGALEKVFSVIRQIRPEIVTVV 118 >XP_016191184.1 PREDICTED: DELLA protein GAIP-B-like [Arachis ipaensis] Length = 603 Score = 60.5 bits (145), Expect = 9e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -3 Query: 458 SVIVNSVFELHRLLIHPGALDKVISVVRQIRPKIVTVV 345 +V VNSVFELH+LL PGA++KV+SVVRQIRP+IVTVV Sbjct: 427 AVAVNSVFELHKLLARPGAVEKVLSVVRQIRPEIVTVV 464 >XP_015957883.1 PREDICTED: DELLA protein GAIP-B-like [Arachis duranensis] Length = 603 Score = 60.5 bits (145), Expect = 9e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -3 Query: 458 SVIVNSVFELHRLLIHPGALDKVISVVRQIRPKIVTVV 345 +V VNSVFELH+LL PGA++KV+SVVRQIRP+IVTVV Sbjct: 427 AVAVNSVFELHKLLARPGAVEKVLSVVRQIRPEIVTVV 464 >AGK07287.1 GAI1 [Rosa hybrid cultivar] Length = 618 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -3 Query: 458 SVIVNSVFELHRLLIHPGALDKVISVVRQIRPKIVTVV 345 SV VNSVFELH+LL PGA+DKV+SVV+Q++P+IVTVV Sbjct: 442 SVAVNSVFELHKLLARPGAIDKVLSVVKQMKPEIVTVV 479 >AFK24645.1 PgDwarf8, partial [Cenchrus americanus] Length = 407 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 455 VIVNSVFELHRLLIHPGALDKVISVVRQIRPKIVTVV 345 + VNSVFELHRLL HPGAL+KV+ VR +RP+IVTVV Sbjct: 319 IAVNSVFELHRLLAHPGALEKVLGTVRAVRPRIVTVV 355 >XP_015895446.1 PREDICTED: DELLA protein GAIP-B-like [Ziziphus jujuba] Length = 502 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -3 Query: 458 SVIVNSVFELHRLLIHPGALDKVISVVRQIRPKIVTVV 345 SV VNSVFELH+LL PGA++KV+SVVRQI+P+IVT+V Sbjct: 326 SVAVNSVFELHKLLARPGAIEKVLSVVRQIKPEIVTMV 363 >Q6EI06.1 RecName: Full=DELLA protein GAIP; AltName: Full=CmGAIP; Short=GAIP; AltName: Full=Gibberellic acid-insensitive phloem protein AAQ96164.1 gibberellic acid insensitive phloem [Cucurbita maxima] Length = 579 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/38 (71%), Positives = 36/38 (94%) Frame = -3 Query: 458 SVIVNSVFELHRLLIHPGALDKVISVVRQIRPKIVTVV 345 SV+VNSVFELH+LL PGA++KV+SVV+Q++P+IVTVV Sbjct: 403 SVVVNSVFELHQLLARPGAIEKVLSVVKQMKPEIVTVV 440 >XP_008467128.1 PREDICTED: DELLA protein GAIP-B [Cucumis melo] Length = 586 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/38 (71%), Positives = 36/38 (94%) Frame = -3 Query: 458 SVIVNSVFELHRLLIHPGALDKVISVVRQIRPKIVTVV 345 SV+VNSVFELH+LL PGAL+KV+SVV+Q++P+I+TVV Sbjct: 410 SVVVNSVFELHKLLARPGALEKVLSVVKQMKPEIMTVV 447 >XP_004150593.1 PREDICTED: DELLA protein GAIP-B [Cucumis sativus] CBX88046.1 gibberellin DELLA protein, partial [Cucumis sativus] KGN51488.1 DELLA protein GAIP-B [Cucumis sativus] Length = 586 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/38 (71%), Positives = 36/38 (94%) Frame = -3 Query: 458 SVIVNSVFELHRLLIHPGALDKVISVVRQIRPKIVTVV 345 SV+VNSVFELH+LL PGAL+KV+SVV+Q++P+I+TVV Sbjct: 410 SVVVNSVFELHKLLARPGALEKVLSVVKQMKPEIMTVV 447 >EEF34604.1 DELLA protein GAIP-B, putative [Ricinus communis] Length = 609 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/38 (71%), Positives = 35/38 (92%) Frame = -3 Query: 458 SVIVNSVFELHRLLIHPGALDKVISVVRQIRPKIVTVV 345 SV VNSVFELH+LL PGA+DKV+SVV+Q++P+IVT+V Sbjct: 432 SVAVNSVFELHKLLARPGAIDKVLSVVKQMKPEIVTIV 469 >XP_015580029.1 PREDICTED: LOW QUALITY PROTEIN: DELLA protein GAIP-B [Ricinus communis] Length = 628 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/38 (71%), Positives = 35/38 (92%) Frame = -3 Query: 458 SVIVNSVFELHRLLIHPGALDKVISVVRQIRPKIVTVV 345 SV VNSVFELH+LL PGA+DKV+SVV+Q++P+IVT+V Sbjct: 451 SVAVNSVFELHKLLARPGAIDKVLSVVKQMKPEIVTIV 488 >XP_003531153.1 PREDICTED: DELLA protein GAI1-like [Glycine max] KRH42544.1 hypothetical protein GLYMA_08G095800 [Glycine max] Length = 517 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -3 Query: 458 SVIVNSVFELHRLLIHPGALDKVISVVRQIRPKIVTVV 345 +V VNSVFE H+LL PGA++KV+SVVRQIRP+IVTVV Sbjct: 344 AVAVNSVFEFHKLLARPGAVEKVLSVVRQIRPEIVTVV 381 >ABO61516.1 GAI1 [Glycine max] Length = 523 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -3 Query: 458 SVIVNSVFELHRLLIHPGALDKVISVVRQIRPKIVTVV 345 SV VNSVFE H+LL PGA++KV+SVVRQIRP+I+TVV Sbjct: 345 SVAVNSVFEFHKLLARPGAVEKVLSVVRQIRPEILTVV 382 >NP_001240948.1 DELLA protein GAI 1 [Glycine max] ACA24488.1 gibberellin insensitive-like protein [Glycine max] KRH58636.1 hypothetical protein GLYMA_05G140400 [Glycine max] Length = 523 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -3 Query: 458 SVIVNSVFELHRLLIHPGALDKVISVVRQIRPKIVTVV 345 SV VNSVFE H+LL PGA++KV+SVVRQIRP+I+TVV Sbjct: 345 SVAVNSVFEFHKLLARPGAVEKVLSVVRQIRPEILTVV 382 >ABI34432.1 CRY [Pisum sativum] Length = 532 Score = 58.9 bits (141), Expect = 3e-07 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -3 Query: 458 SVIVNSVFELHRLLIHPGALDKVISVVRQIRPKIVTVV 345 SV VNSVFELH+L PGAL+KV SV+RQIRP+IVTVV Sbjct: 354 SVAVNSVFELHKLNARPGALEKVFSVIRQIRPEIVTVV 391 >XP_004504565.1 PREDICTED: DELLA protein GAI1-like [Cicer arietinum] Length = 537 Score = 58.9 bits (141), Expect = 3e-07 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -3 Query: 458 SVIVNSVFELHRLLIHPGALDKVISVVRQIRPKIVTVV 345 SV VNSVFELH+L PGAL+KV SV+RQIRP+IVTVV Sbjct: 359 SVAVNSVFELHKLNARPGALEKVFSVIRQIRPEIVTVV 396 >GAU44521.1 hypothetical protein TSUD_82270 [Trifolium subterraneum] Length = 538 Score = 58.9 bits (141), Expect = 3e-07 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -3 Query: 458 SVIVNSVFELHRLLIHPGALDKVISVVRQIRPKIVTVV 345 SV VNSVFELH+L PGAL+KV SV+RQIRP+IVTVV Sbjct: 359 SVAVNSVFELHKLNARPGALEKVFSVIRQIRPEIVTVV 396 >XP_020104070.1 DELLA protein SLN1-like, partial [Ananas comosus] Length = 350 Score = 58.5 bits (140), Expect = 3e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 458 SVIVNSVFELHRLLIHPGALDKVISVVRQIRPKIVTVV 345 +V VNSVFELHRLL PGAL+KV+ VR +RPKIVTVV Sbjct: 158 AVAVNSVFELHRLLARPGALEKVLGTVRAVRPKIVTVV 195 >XP_007225630.1 hypothetical protein PRUPE_ppa005944mg [Prunus persica] ONI31763.1 hypothetical protein PRUPE_1G329600 [Prunus persica] Length = 436 Score = 58.5 bits (140), Expect = 4e-07 Identities = 27/38 (71%), Positives = 35/38 (92%) Frame = -3 Query: 458 SVIVNSVFELHRLLIHPGALDKVISVVRQIRPKIVTVV 345 SV VNSVFELH+LL PGA++KV+SVV+Q++P+IVTVV Sbjct: 260 SVAVNSVFELHKLLARPGAIEKVLSVVKQMKPEIVTVV 297 >XP_010101954.1 hypothetical protein L484_011971 [Morus notabilis] EXB90878.1 hypothetical protein L484_011971 [Morus notabilis] Length = 477 Score = 58.5 bits (140), Expect = 4e-07 Identities = 27/38 (71%), Positives = 35/38 (92%) Frame = -3 Query: 458 SVIVNSVFELHRLLIHPGALDKVISVVRQIRPKIVTVV 345 SV VNSVFELH+LL PGA++KV+SVV+Q++P+IVTVV Sbjct: 300 SVAVNSVFELHKLLARPGAIEKVLSVVKQMKPEIVTVV 337