BLASTX nr result
ID: Glycyrrhiza33_contig00016004
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00016004 (481 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_004222334.1 hypothetical protein BevumaM_p100 (mitochondrion)... 76 2e-14 BAD66717.1 orf169 (mitochondrion) [Beta vulgaris subsp. vulgaris] 76 2e-14 NP_064093.1 orf211 gene product (mitochondrion) [Beta vulgaris s... 76 4e-14 >YP_004222334.1 hypothetical protein BevumaM_p100 (mitochondrion) [Beta vulgaris subsp. maritima] YP_004842140.1 hypothetical protein BemaM_p096 (mitochondrion) [Beta macrocarpa] CBJ14065.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBJ17556.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBJ20726.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBX24945.1 hypothetical protein (mitochondrion) [Beta macrocarpa] CBL51974.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 169 Score = 76.3 bits (186), Expect = 2e-14 Identities = 41/54 (75%), Positives = 42/54 (77%) Frame = -2 Query: 324 PKSVGPTTTRGNHTWTNEISLSLTFWRQKPVSPARAHRGVSRSNVKYSGGLPAF 163 PKSVGPTTTR NHT TNEI LSL F+ KPVSPARAHRGVSR VK GLP F Sbjct: 61 PKSVGPTTTRDNHTRTNEIFLSL-FFCAKPVSPARAHRGVSRDIVKEKTGLPTF 113 >BAD66717.1 orf169 (mitochondrion) [Beta vulgaris subsp. vulgaris] Length = 169 Score = 76.3 bits (186), Expect = 2e-14 Identities = 41/54 (75%), Positives = 42/54 (77%) Frame = -2 Query: 324 PKSVGPTTTRGNHTWTNEISLSLTFWRQKPVSPARAHRGVSRSNVKYSGGLPAF 163 PKSVGPTTTR NHT TNEI LSL F+ KPVSPARAHRGVSR VK GLP F Sbjct: 61 PKSVGPTTTRDNHTRTNEIFLSL-FFCAKPVSPARAHRGVSRDIVKEKTGLPTF 113 >NP_064093.1 orf211 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] BAA99486.1 orf211 (mitochondrion) [Beta vulgaris subsp. vulgaris] Length = 211 Score = 76.3 bits (186), Expect = 4e-14 Identities = 41/54 (75%), Positives = 42/54 (77%) Frame = -2 Query: 324 PKSVGPTTTRGNHTWTNEISLSLTFWRQKPVSPARAHRGVSRSNVKYSGGLPAF 163 PKSVGPTTTR NHT TNEI LSL F+ KPVSPARAHRGVSR VK GLP F Sbjct: 61 PKSVGPTTTRDNHTRTNEIFLSL-FFCAKPVSPARAHRGVSRDIVKEKTGLPTF 113