BLASTX nr result
ID: Glycyrrhiza33_contig00015645
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00015645 (413 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMP13262.1 hypothetical protein COLO4_01988 [Corchorus olitorius] 110 5e-29 NP_054552.1 hypothetical protein NitaCp078 [Nicotiana tabacum] N... 107 5e-28 XP_006435528.1 hypothetical protein CICLE_v10010881mg [Citrus cl... 85 7e-19 OMP07296.1 hypothetical protein COLO4_07468 [Corchorus olitorius] 77 1e-14 OAY56484.1 hypothetical protein MANES_02G020200, partial [Maniho... 66 5e-12 KDP22997.1 hypothetical protein JCGZ_01719 [Jatropha curcas] 66 7e-10 KMS94058.1 hypothetical protein BVRB_025220 [Beta vulgaris subsp... 59 2e-09 KVH98711.1 Maturase MatK, N-terminal domain-containing protein, ... 62 1e-08 XP_015970394.1 PREDICTED: uncharacterized protein LOC107493875 [... 61 3e-08 KZV38793.1 hypothetical protein F511_19843 [Dorcoceras hygrometr... 52 2e-06 >OMP13262.1 hypothetical protein COLO4_01988 [Corchorus olitorius] Length = 82 Score = 110 bits (274), Expect = 5e-29 Identities = 59/82 (71%), Positives = 65/82 (79%) Frame = -1 Query: 374 VEQRSIPNLHRGIDGYSQISQNRMGYDEIQCNRNKDRGNELPTLT*WSKQTVSFRIL*FG 195 +EQR IP+LHRGIDG SQISQNRMGYDEI+CNRNKD GN LP L S+ S IL +G Sbjct: 1 MEQRIIPDLHRGIDGDSQISQNRMGYDEIECNRNKDTGNGLPALNGQSEPFHS-DILEYG 59 Query: 194 INQISPSRT*TYDQSVNSRPLY 129 +NQIS SR TYDQSVNSRPLY Sbjct: 60 MNQISSSRIRTYDQSVNSRPLY 81 >NP_054552.1 hypothetical protein NitaCp078 [Nicotiana tabacum] NP_054565.1 hypothetical protein NitaCp091 [Nicotiana tabacum] YP_358732.1 hypothetical protein NisyCp089 [Nicotiana sylvestris] YP_358746.1 hypothetical protein NisyCp103 [Nicotiana sylvestris] YP_398918.1 hypothetical protein NitoCp088 [Nicotiana tomentosiformis] YP_398932.1 hypothetical protein NitoCp102 [Nicotiana tomentosiformis] YP_004891661.1 unnamed protein product (chloroplast) [Nicotiana undulata] YP_004891675.1 unnamed protein product (chloroplast) [Nicotiana undulata] CAA26288.1 hypothetical protein (chloroplast) [Nicotiana tabacum] CAA77393.1 hypothetical protein (chloroplast) [Nicotiana tabacum] AAA84690.1 unknown (chloroplast) [Nicotiana tabacum] CAA77400.1 hypothetical protein (chloroplast) [Nicotiana tabacum] BAE46709.1 hypothetical protein (chloroplast) [Nicotiana sylvestris] BAE46723.1 hypothetical protein (chloroplast) [Nicotiana sylvestris] BAE48058.1 hypothetical protein (chloroplast) [Nicotiana tomentosiformis] BAE48072.1 hypothetical protein (chloroplast) [Nicotiana tomentosiformis] AEO95619.1 hypothetical protein (chloroplast) [Nicotiana undulata] AEO95646.1 hypothetical protein (chloroplast) [Nicotiana undulata] AEO95728.1 hypothetical protein [synthetic construct] AEO95754.1 hypothetical protein [synthetic construct] AMM05595.1 hypothetical protein (plastid) [Nicotiana tabacum] prf||1211235CK ORF 75 Length = 75 Score = 107 bits (267), Expect = 5e-28 Identities = 58/70 (82%), Positives = 65/70 (92%) Frame = +3 Query: 6 PLRRSSTSYKKGNFELILMMG*EQE*NSMRSNLPVFLSSSVVERSAVNRLVVGSSPTWGD 185 PLRRSS SY+ G+FELIL+MG E+E NSMRSNL +FLSSSVVERSAVNRLVVGS+PTWGD Sbjct: 7 PLRRSSGSYE-GSFELILVMGWERELNSMRSNLLLFLSSSVVERSAVNRLVVGSNPTWGD 65 Query: 186 LINSELKNSE 215 LI+SELKNSE Sbjct: 66 LIDSELKNSE 75 >XP_006435528.1 hypothetical protein CICLE_v10010881mg [Citrus clementina] ESR48768.1 hypothetical protein CICLE_v10010881mg [Citrus clementina] Length = 108 Score = 85.1 bits (209), Expect = 7e-19 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -1 Query: 383 PRTVEQRSIPNLHRGIDGYSQISQNRMGYDEIQCNRNKDRGNELPT 246 PRT+EQR IP+LHRGIDG SQISQNRMGYDEI+CNRNKD GN LPT Sbjct: 38 PRTMEQRIIPDLHRGIDGDSQISQNRMGYDEIECNRNKDTGNGLPT 83 >OMP07296.1 hypothetical protein COLO4_07468 [Corchorus olitorius] Length = 193 Score = 76.6 bits (187), Expect = 1e-14 Identities = 37/55 (67%), Positives = 45/55 (81%) Frame = -2 Query: 202 NSELIKSPQVGLEPTTNRLTADRSTTELLRNTGKFDLIEFYSCSQPIINMSSKFP 38 N+ L++ Q G EPTT++LTADRSTTELLRN G+ DLIEF S SQP+ NM+SKFP Sbjct: 116 NTALVEFSQDGFEPTTSQLTADRSTTELLRNNGRLDLIEFNSRSQPMTNMNSKFP 170 >OAY56484.1 hypothetical protein MANES_02G020200, partial [Manihot esculenta] Length = 42 Score = 65.9 bits (159), Expect = 5e-12 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -2 Query: 160 TTNRLTADRSTTELLRNTGKFDLIEFYSCSQPIINMSSKFP 38 TT++LTADRSTTELLRN G+ DLIEF S SQP+ NMSSKFP Sbjct: 1 TTSQLTADRSTTELLRNNGRLDLIEFNSRSQPMTNMSSKFP 41 >KDP22997.1 hypothetical protein JCGZ_01719 [Jatropha curcas] Length = 742 Score = 65.9 bits (159), Expect = 7e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -2 Query: 157 TNRLTADRSTTELLRNTGKFDLIEFYSCSQPIINMSSKFP 38 TN+LTADRSTTELLRN G+FDLIEF S SQP+ NMS KFP Sbjct: 702 TNQLTADRSTTELLRNNGRFDLIEFNSRSQPMTNMSLKFP 741 >KMS94058.1 hypothetical protein BVRB_025220 [Beta vulgaris subsp. vulgaris] Length = 42 Score = 58.9 bits (141), Expect = 2e-09 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -2 Query: 157 TNRLTADRSTTELLRNTGKFDLIEFYSCSQPIINMSSKFP 38 TN+LT DRSTTELLRN + DLIEF S SQP+ NMSSK P Sbjct: 2 TNQLTTDRSTTELLRNNKRLDLIEFNSRSQPMTNMSSKLP 41 >KVH98711.1 Maturase MatK, N-terminal domain-containing protein, partial [Cynara cardunculus var. scolymus] Length = 276 Score = 61.6 bits (148), Expect = 1e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 193 LIKSPQVGLEPTTNRLTADRSTTELLRNTGKFD 95 + KSPQVG EPTTNRLTADRSTTELLRN G+FD Sbjct: 3 IFKSPQVGFEPTTNRLTADRSTTELLRNNGRFD 35 >XP_015970394.1 PREDICTED: uncharacterized protein LOC107493875 [Arachis duranensis] Length = 425 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -1 Query: 377 TVEQRSIPNLHRGIDGYSQISQNRMGYDEIQCNRNKDR 264 T+EQ SI NLHRGIDG SQISQN+ GYDEI+CNR+K + Sbjct: 181 TLEQGSILNLHRGIDGDSQISQNQTGYDEIECNRDKQK 218 >KZV38793.1 hypothetical protein F511_19843 [Dorcoceras hygrometricum] KZV51010.1 hypothetical protein F511_18990 [Dorcoceras hygrometricum] Length = 56 Score = 52.0 bits (123), Expect = 2e-06 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = -2 Query: 163 PTTNRLTADRSTTELLRNTGKFDLIEFYSCSQPIINMSSKFP 38 PT N T DRSTTELLRN G+ DL+EF S SQP+ NMSS P Sbjct: 15 PTLNGQT-DRSTTELLRNNGRLDLLEFNSRSQPMTNMSSNPP 55