BLASTX nr result
ID: Glycyrrhiza33_contig00015388
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00015388 (345 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003628499.1 hypothetical protein MTR_8g059780 [Medicago trunc... 62 2e-10 >XP_003628499.1 hypothetical protein MTR_8g059780 [Medicago truncatula] AET02975.1 hypothetical protein MTR_8g059780 [Medicago truncatula] Length = 81 Score = 62.0 bits (149), Expect = 2e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 245 MADPVEVHFVLLSDQESESNRLHRQDWRVLIHF 343 MA+PVEV+FVLLSDQESESNRLHRQD RVLIHF Sbjct: 1 MANPVEVNFVLLSDQESESNRLHRQDRRVLIHF 33