BLASTX nr result
ID: Glycyrrhiza33_contig00015260
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00015260 (358 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH74304.1 hypothetical protein GLYMA_01G011200 [Glycine max] 85 9e-17 XP_003516883.1 PREDICTED: extra-large guanine nucleotide-binding... 85 9e-17 XP_007158218.1 hypothetical protein PHAVU_002G134200g [Phaseolus... 84 1e-16 XP_019421491.1 PREDICTED: extra-large guanine nucleotide-binding... 84 2e-16 XP_014520827.1 PREDICTED: extra-large guanine nucleotide-binding... 84 2e-16 XP_014520825.1 PREDICTED: extra-large guanine nucleotide-binding... 84 2e-16 OIV94428.1 hypothetical protein TanjilG_25490 [Lupinus angustifo... 84 2e-16 XP_004512458.1 PREDICTED: extra-large guanine nucleotide-binding... 83 3e-16 XP_016201188.1 PREDICTED: extra-large guanine nucleotide-binding... 83 3e-16 XP_015963235.1 PREDICTED: extra-large guanine nucleotide-binding... 83 3e-16 XP_017427325.1 PREDICTED: extra-large guanine nucleotide-binding... 83 4e-16 XP_017427321.1 PREDICTED: extra-large guanine nucleotide-binding... 83 4e-16 XP_013453656.1 extra-large GTP-binding protein [Medicago truncat... 81 1e-15 XP_003612703.1 extra-large GTP-binding protein [Medicago truncat... 81 2e-15 XP_003534299.1 PREDICTED: extra-large guanine nucleotide-binding... 80 3e-15 GAU49039.1 hypothetical protein TSUD_236960 [Trifolium subterran... 78 2e-14 XP_007210372.1 hypothetical protein PRUPE_ppa001297mg [Prunus pe... 77 3e-14 XP_008238143.1 PREDICTED: extra-large guanine nucleotide-binding... 76 1e-13 XP_015868325.1 PREDICTED: extra-large guanine nucleotide-binding... 74 6e-13 XP_015897315.1 PREDICTED: extra-large guanine nucleotide-binding... 74 6e-13 >KRH74304.1 hypothetical protein GLYMA_01G011200 [Glycine max] Length = 627 Score = 84.7 bits (208), Expect = 9e-17 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +2 Query: 227 MDPNRGDSWRELVKKMLPPGASVPDDASNLDYSIALEYVGPPV 355 MD NRG+SWRELVKKMLPPGAS+P DASNLDYSIA+EYVGPPV Sbjct: 1 MDQNRGESWRELVKKMLPPGASIPADASNLDYSIAMEYVGPPV 43 >XP_003516883.1 PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Glycine max] XP_006572944.1 PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Glycine max] KRH74301.1 hypothetical protein GLYMA_01G011200 [Glycine max] KRH74302.1 hypothetical protein GLYMA_01G011200 [Glycine max] KRH74303.1 hypothetical protein GLYMA_01G011200 [Glycine max] Length = 860 Score = 84.7 bits (208), Expect = 9e-17 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +2 Query: 227 MDPNRGDSWRELVKKMLPPGASVPDDASNLDYSIALEYVGPPV 355 MD NRG+SWRELVKKMLPPGAS+P DASNLDYSIA+EYVGPPV Sbjct: 1 MDQNRGESWRELVKKMLPPGASIPADASNLDYSIAMEYVGPPV 43 >XP_007158218.1 hypothetical protein PHAVU_002G134200g [Phaseolus vulgaris] XP_007158219.1 hypothetical protein PHAVU_002G134200g [Phaseolus vulgaris] XP_007158220.1 hypothetical protein PHAVU_002G134200g [Phaseolus vulgaris] ESW30212.1 hypothetical protein PHAVU_002G134200g [Phaseolus vulgaris] ESW30213.1 hypothetical protein PHAVU_002G134200g [Phaseolus vulgaris] ESW30214.1 hypothetical protein PHAVU_002G134200g [Phaseolus vulgaris] Length = 861 Score = 84.3 bits (207), Expect = 1e-16 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +2 Query: 227 MDPNRGDSWRELVKKMLPPGASVPDDASNLDYSIALEYVGPPV 355 MD NRG+SWRELVKKMLPPGAS+P DASNLDYSIA+EYVGPPV Sbjct: 1 MDQNRGESWRELVKKMLPPGASIPVDASNLDYSIAMEYVGPPV 43 >XP_019421491.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 isoform X1 [Lupinus angustifolius] XP_019421492.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 isoform X2 [Lupinus angustifolius] XP_019421493.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 isoform X1 [Lupinus angustifolius] XP_019421495.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 isoform X1 [Lupinus angustifolius] XP_019421496.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 isoform X1 [Lupinus angustifolius] Length = 853 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +2 Query: 227 MDPNRGDSWRELVKKMLPPGASVPDDASNLDYSIALEYVGPPVP 358 MD NRG+SWRELVKKMLPPGASVPDD+SNLDYSIALEY GP +P Sbjct: 1 MDQNRGESWRELVKKMLPPGASVPDDSSNLDYSIALEYEGPRLP 44 >XP_014520827.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 isoform X2 [Vigna radiata var. radiata] Length = 857 Score = 83.6 bits (205), Expect = 2e-16 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +2 Query: 227 MDPNRGDSWRELVKKMLPPGASVPDDASNLDYSIALEYVGPPV 355 MD NR +SWREL+KKMLPPGAS+PDDASNLDYSIA+EYVGPPV Sbjct: 1 MDQNREESWRELMKKMLPPGASIPDDASNLDYSIAMEYVGPPV 43 >XP_014520825.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 isoform X1 [Vigna radiata var. radiata] XP_014520826.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 isoform X1 [Vigna radiata var. radiata] Length = 863 Score = 83.6 bits (205), Expect = 2e-16 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +2 Query: 227 MDPNRGDSWRELVKKMLPPGASVPDDASNLDYSIALEYVGPPV 355 MD NR +SWREL+KKMLPPGAS+PDDASNLDYSIA+EYVGPPV Sbjct: 1 MDQNREESWRELMKKMLPPGASIPDDASNLDYSIAMEYVGPPV 43 >OIV94428.1 hypothetical protein TanjilG_25490 [Lupinus angustifolius] Length = 995 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +2 Query: 227 MDPNRGDSWRELVKKMLPPGASVPDDASNLDYSIALEYVGPPVP 358 MD NRG+SWRELVKKMLPPGASVPDD+SNLDYSIALEY GP +P Sbjct: 1 MDQNRGESWRELVKKMLPPGASVPDDSSNLDYSIALEYEGPRLP 44 >XP_004512458.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 isoform X1 [Cicer arietinum] Length = 837 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = +2 Query: 227 MDPNRGDSWRELVKKMLPPGASVPDDASNLDYSIALEYVGPPV 355 MD NRGDSWRELVK M+P GASVPDDASNLDYSIALEY+GPPV Sbjct: 1 MDHNRGDSWRELVKNMIPSGASVPDDASNLDYSIALEYLGPPV 43 >XP_016201188.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 [Arachis ipaensis] Length = 863 Score = 83.2 bits (204), Expect = 3e-16 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +2 Query: 227 MDPNRGDSWRELVKKMLPPGASVPDDASNLDYSIALEYVGPPV 355 MD N+G+SWRELVKKMLPPGASVPDD SNLDYSIA+EY GPPV Sbjct: 1 MDQNKGESWRELVKKMLPPGASVPDDGSNLDYSIAMEYKGPPV 43 >XP_015963235.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 [Arachis duranensis] Length = 863 Score = 83.2 bits (204), Expect = 3e-16 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +2 Query: 227 MDPNRGDSWRELVKKMLPPGASVPDDASNLDYSIALEYVGPPV 355 MD N+G+SWRELVKKMLPPGASVPDD SNLDYSIA+EY GPPV Sbjct: 1 MDQNKGESWRELVKKMLPPGASVPDDGSNLDYSIAMEYKGPPV 43 >XP_017427325.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 isoform X2 [Vigna angularis] KOM45473.1 hypothetical protein LR48_Vigan06g077900 [Vigna angularis] Length = 857 Score = 82.8 bits (203), Expect = 4e-16 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +2 Query: 227 MDPNRGDSWRELVKKMLPPGASVPDDASNLDYSIALEYVGPPV 355 MD NR +SWREL+KKMLPPGAS+PDDASNLDYSIA+EYVGPPV Sbjct: 1 MDQNREESWRELMKKMLPPGASLPDDASNLDYSIAMEYVGPPV 43 >XP_017427321.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 isoform X1 [Vigna angularis] XP_017427323.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 isoform X1 [Vigna angularis] XP_017427324.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 isoform X1 [Vigna angularis] BAT99682.1 hypothetical protein VIGAN_10118500 [Vigna angularis var. angularis] Length = 863 Score = 82.8 bits (203), Expect = 4e-16 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +2 Query: 227 MDPNRGDSWRELVKKMLPPGASVPDDASNLDYSIALEYVGPPV 355 MD NR +SWREL+KKMLPPGAS+PDDASNLDYSIA+EYVGPPV Sbjct: 1 MDQNREESWRELMKKMLPPGASLPDDASNLDYSIAMEYVGPPV 43 >XP_013453656.1 extra-large GTP-binding protein [Medicago truncatula] KEH27687.1 extra-large GTP-binding protein [Medicago truncatula] Length = 605 Score = 81.3 bits (199), Expect = 1e-15 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = +2 Query: 227 MDPNRGDSWRELVKKMLPPGASVPDDASNLDYSIALEYVGPPV 355 MD NRGD+W+E+VKKMLPPGASVPDDASNLDYS A EY+GPPV Sbjct: 1 MDHNRGDNWKEVVKKMLPPGASVPDDASNLDYSTASEYLGPPV 43 >XP_003612703.1 extra-large GTP-binding protein [Medicago truncatula] AES95661.1 extra-large GTP-binding protein [Medicago truncatula] Length = 839 Score = 81.3 bits (199), Expect = 2e-15 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = +2 Query: 227 MDPNRGDSWRELVKKMLPPGASVPDDASNLDYSIALEYVGPPV 355 MD NRGD+W+E+VKKMLPPGASVPDDASNLDYS A EY+GPPV Sbjct: 1 MDHNRGDNWKEVVKKMLPPGASVPDDASNLDYSTASEYLGPPV 43 >XP_003534299.1 PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Glycine max] XP_006587617.1 PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Glycine max] KRH39620.1 hypothetical protein GLYMA_09G209900 [Glycine max] Length = 861 Score = 80.5 bits (197), Expect = 3e-15 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = +2 Query: 227 MDPNRGDSWRELVKKMLPPGASVPDDASNLDYSIALEYVGPPV 355 MD NR +SWR+LVKKMLPPGAS+P DASNLDYSIA+EYVGPPV Sbjct: 1 MDQNRDESWRKLVKKMLPPGASIPADASNLDYSIAMEYVGPPV 43 >GAU49039.1 hypothetical protein TSUD_236960 [Trifolium subterraneum] Length = 644 Score = 77.8 bits (190), Expect = 2e-14 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = +2 Query: 227 MDPNRGDSWRELVKKMLPPGASVPDDASNLDYSIALEYVGPPVP 358 MD +RGDSWR LV MLPPGASVPDD +N DYS+ALEY+GPPVP Sbjct: 1 MDHSRGDSWRGLVNNMLPPGASVPDDVTNSDYSVALEYLGPPVP 44 >XP_007210372.1 hypothetical protein PRUPE_ppa001297mg [Prunus persica] ONI05837.1 hypothetical protein PRUPE_5G026100 [Prunus persica] ONI05838.1 hypothetical protein PRUPE_5G026100 [Prunus persica] ONI05839.1 hypothetical protein PRUPE_5G026100 [Prunus persica] ONI05840.1 hypothetical protein PRUPE_5G026100 [Prunus persica] ONI05841.1 hypothetical protein PRUPE_5G026100 [Prunus persica] ONI05842.1 hypothetical protein PRUPE_5G026100 [Prunus persica] ONI05843.1 hypothetical protein PRUPE_5G026100 [Prunus persica] ONI05844.1 hypothetical protein PRUPE_5G026100 [Prunus persica] ONI05845.1 hypothetical protein PRUPE_5G026100 [Prunus persica] ONI05846.1 hypothetical protein PRUPE_5G026100 [Prunus persica] Length = 861 Score = 77.4 bits (189), Expect = 3e-14 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = +2 Query: 227 MDPNRGDSWRELVKKMLPPGASVPDDASNLDYSIALEYVGPPV 355 M+ G+SWRELV+KMLPPGAS+P+DAS+LDYSIA+EYVGPPV Sbjct: 1 MEQKEGESWRELVRKMLPPGASIPEDASDLDYSIAMEYVGPPV 43 >XP_008238143.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 [Prunus mume] XP_008238144.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 [Prunus mume] XP_008238145.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 [Prunus mume] XP_008238146.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 [Prunus mume] XP_008238147.1 PREDICTED: extra-large guanine nucleotide-binding protein 3 [Prunus mume] Length = 861 Score = 75.9 bits (185), Expect = 1e-13 Identities = 31/43 (72%), Positives = 40/43 (93%) Frame = +2 Query: 227 MDPNRGDSWRELVKKMLPPGASVPDDASNLDYSIALEYVGPPV 355 M+ G+SWRELV+KMLPPGAS+P+DAS+LDYSIA+EY+GPP+ Sbjct: 1 MEQKEGESWRELVRKMLPPGASIPEDASDLDYSIAMEYLGPPI 43 >XP_015868325.1 PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Ziziphus jujuba] Length = 865 Score = 73.9 bits (180), Expect = 6e-13 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = +2 Query: 227 MDPNRGDSWRELVKKMLPPGASVPDDASNLDYSIALEYVGPPV 355 M+ N G+SWRELV++MLPPGAS+P+DAS LDYSIA+EY GPPV Sbjct: 1 MEKNEGESWRELVRQMLPPGASLPEDASYLDYSIAMEYEGPPV 43 >XP_015897315.1 PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Ziziphus jujuba] Length = 865 Score = 73.9 bits (180), Expect = 6e-13 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = +2 Query: 227 MDPNRGDSWRELVKKMLPPGASVPDDASNLDYSIALEYVGPPV 355 M+ N G+SWRELV++MLPPGAS+P+DAS LDYSIA+EY GPPV Sbjct: 1 MEKNEGESWRELVRQMLPPGASLPEDASYLDYSIAMEYEGPPV 43