BLASTX nr result
ID: Glycyrrhiza33_contig00013868
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00013868 (590 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013464157.1 hypothetical protein MTR_2g062865 [Medicago trunc... 57 1e-07 >XP_013464157.1 hypothetical protein MTR_2g062865 [Medicago truncatula] KEH38192.1 hypothetical protein MTR_2g062865 [Medicago truncatula] Length = 94 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = +3 Query: 189 NSTSQNWLVR*GPSKPYKHYLGHISRRCGTKHNPSNPTQ 305 NST Q+WL+R G + YKHY HISR+CGTK PS+PTQ Sbjct: 56 NSTLQDWLIRRGLPELYKHYTAHISRQCGTKLKPSHPTQ 94