BLASTX nr result
ID: Glycyrrhiza33_contig00013683
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00013683 (501 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_173442.1 hypothetical protein NitaMp104 [Nicotiana tabacum] B... 83 1e-17 EYU34039.1 hypothetical protein MIMGU_mgv11b016421mg [Erythranth... 78 4e-16 >YP_173442.1 hypothetical protein NitaMp104 [Nicotiana tabacum] BAD83507.1 hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 118 Score = 83.2 bits (204), Expect = 1e-17 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = -3 Query: 130 MGTAPPAARVFDPKGMENETRICVHYLWSGVTILNLLFPISP 5 MGTAP AARV DPKGMENE RICVHYLWSGVTILNLLFPISP Sbjct: 1 MGTAPLAARVSDPKGMENERRICVHYLWSGVTILNLLFPISP 42 >EYU34039.1 hypothetical protein MIMGU_mgv11b016421mg [Erythranthe guttata] Length = 69 Score = 77.8 bits (190), Expect = 4e-16 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -3 Query: 130 MGTAPPAARVFDPKGMENETRICVHYLWSGVTILNLLFPISP 5 MGTAPPAARV DPKG+ENE ICVHYLWSGVTI +L+FPISP Sbjct: 1 MGTAPPAARVSDPKGIENERGICVHYLWSGVTIQHLIFPISP 42