BLASTX nr result
ID: Glycyrrhiza33_contig00013655
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00013655 (376 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012573509.1 PREDICTED: zinc finger BED domain-containing prot... 65 9e-10 XP_014621065.1 PREDICTED: zinc finger BED domain-containing prot... 60 5e-08 KHN03605.1 Putative AC transposase [Glycine soja] 60 5e-08 XP_007155048.1 hypothetical protein PHAVU_003G168600g [Phaseolus... 59 2e-07 XP_012573510.1 PREDICTED: zinc finger BED domain-containing prot... 54 5e-06 >XP_012573509.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X1 [Cicer arietinum] Length = 1066 Score = 65.1 bits (157), Expect = 9e-10 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +1 Query: 259 EDSYQNKMVTVEEDKVVVTPEVKSAPVSADFQPSNDLAN 375 ED+Y NKMVTVEEDKVV TP++K+APV+ D +PSNDLAN Sbjct: 2 EDTYWNKMVTVEEDKVVATPDIKNAPVNPDIKPSNDLAN 40 >XP_014621065.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] XP_014621066.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] XP_014621067.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] KRH20154.1 hypothetical protein GLYMA_13G160000 [Glycine max] Length = 1180 Score = 60.1 bits (144), Expect = 5e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 280 MVTVEEDKVVVTPEVKSAPVSADFQPSNDLAN 375 MVTVEEDKVV TP+VK+APVS DFQPSNDLAN Sbjct: 1 MVTVEEDKVVATPDVKNAPVSTDFQPSNDLAN 32 >KHN03605.1 Putative AC transposase [Glycine soja] Length = 1180 Score = 60.1 bits (144), Expect = 5e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 280 MVTVEEDKVVVTPEVKSAPVSADFQPSNDLAN 375 MVTVEEDKVV TP+VK+APVS DFQPSNDLAN Sbjct: 1 MVTVEEDKVVATPDVKNAPVSTDFQPSNDLAN 32 >XP_007155048.1 hypothetical protein PHAVU_003G168600g [Phaseolus vulgaris] ESW27042.1 hypothetical protein PHAVU_003G168600g [Phaseolus vulgaris] Length = 1252 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 280 MVTVEEDKVVVTPEVKSAPVSADFQPSNDLAN 375 MVTVEEDKVV TP+VK+APVS DFQPSNDL N Sbjct: 1 MVTVEEDKVVATPDVKNAPVSTDFQPSNDLVN 32 >XP_012573510.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X2 [Cicer arietinum] XP_012573511.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X2 [Cicer arietinum] XP_012573512.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X2 [Cicer arietinum] Length = 1058 Score = 54.3 bits (129), Expect = 5e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 280 MVTVEEDKVVVTPEVKSAPVSADFQPSNDLAN 375 MVTVEEDKVV TP++K+APV+ D +PSNDLAN Sbjct: 1 MVTVEEDKVVATPDIKNAPVNPDIKPSNDLAN 32