BLASTX nr result
ID: Glycyrrhiza33_contig00013549
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00013549 (715 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_006291838.1 orf49 (mitochondrion) [Daucus carota subsp. sativ... 123 9e-32 XP_010088916.1 hypothetical protein L484_018543 [Morus notabilis... 57 5e-06 >YP_006291838.1 orf49 (mitochondrion) [Daucus carota subsp. sativus] AEY81187.1 orf49 (mitochondrion) [Daucus carota subsp. sativus] Length = 161 Score = 123 bits (308), Expect = 9e-32 Identities = 69/90 (76%), Positives = 71/90 (78%), Gaps = 3/90 (3%) Frame = +2 Query: 395 MDPIPYIEH*ILSIDRKIFVKYRCL-FFSNSSDSYPRQLTTSTPPHTTSWG--SPF*SNK 565 MDPIPYIEH LSIDRKIFVKYR FF NSS YPRQL TSTPPHTTSWG SPF SNK Sbjct: 1 MDPIPYIEHSFLSIDRKIFVKYRTFPFFKNSS--YPRQLITSTPPHTTSWGGCSPFESNK 58 Query: 566 VSISSRGFIATFILKETEEPTFSQ*EPYFP 655 V SSRGFIATF+LKE+EEPTFSQ P Sbjct: 59 V--SSRGFIATFVLKESEEPTFSQIRALLP 86 >XP_010088916.1 hypothetical protein L484_018543 [Morus notabilis] EXB37120.1 hypothetical protein L484_018543 [Morus notabilis] Length = 240 Score = 56.6 bits (135), Expect = 5e-06 Identities = 31/44 (70%), Positives = 32/44 (72%) Frame = +1 Query: 67 GSCILFSSRELPDRRSIRNGLRVHFVGRNDPQSIRGFGEPKEVF 198 GS ILFSS+EL DRRSIRNGLRVHFVGR DP G PK F Sbjct: 194 GSSILFSSQELLDRRSIRNGLRVHFVGRKDPIH---SGNPKTKF 234