BLASTX nr result
ID: Glycyrrhiza33_contig00013514
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00013514 (636 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004498465.1 PREDICTED: nuclear pore complex protein NUP85 [Ci... 54 1e-06 GAU21181.1 hypothetical protein TSUD_10980 [Trifolium subterraneum] 58 3e-06 BAF45348.1 nucleoporin [Lotus japonicus] 50 8e-06 >XP_004498465.1 PREDICTED: nuclear pore complex protein NUP85 [Cicer arietinum] Length = 709 Score = 53.9 bits (128), Expect(2) = 1e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +1 Query: 169 LYSPVFRVDISWSRSNSLCVSLFAKPSGSPDVREGAKIVEVK 294 L P+ R+ ISWSR NSL VSLFA+PS +P+ +GAK+VEVK Sbjct: 31 LARPISRLAISWSRGNSLRVSLFAEPSVNPNTGDGAKVVEVK 72 Score = 26.6 bits (57), Expect(2) = 1e-06 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +2 Query: 341 RSSPFALSKAPSQYHLDF 394 RSS LSK+PS YHLD+ Sbjct: 103 RSSLSELSKSPSPYHLDW 120 >GAU21181.1 hypothetical protein TSUD_10980 [Trifolium subterraneum] Length = 707 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = +1 Query: 169 LYSPVFRVDISWSRSNSLCVSLFAKPSGSPDVREGAKIVEVK 294 L P+ RV +SWSR NSL VSLFA+PSGS D +GAK++EVK Sbjct: 31 LVRPISRVALSWSRGNSLRVSLFAEPSGSSDAGDGAKVIEVK 72 >BAF45348.1 nucleoporin [Lotus japonicus] Length = 711 Score = 50.1 bits (118), Expect(2) = 8e-06 Identities = 30/47 (63%), Positives = 34/47 (72%), Gaps = 2/47 (4%) Frame = +1 Query: 178 PVFRVDISWSRSNSLCVSLFAKPSG-SPDVR-EGAKIVEVKPPLEAP 312 P+ RV ISWSR NSL VSLFA+PS SPD + GAK+VEVK E P Sbjct: 34 PISRVAISWSRGNSLRVSLFAEPSATSPDSQASGAKVVEVKLSGEDP 80 Score = 27.3 bits (59), Expect(2) = 8e-06 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 341 RSSPFALSKAPSQYHLDF 394 RSS ALSK+PS YH+D+ Sbjct: 105 RSSLAALSKSPSPYHVDW 122