BLASTX nr result
ID: Glycyrrhiza33_contig00013166
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00013166 (333 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP71628.1 Auxin response factor 7 [Cajanus cajan] 61 1e-08 XP_006604696.1 PREDICTED: auxin response factor 2-like [Glycine ... 59 8e-08 XP_014495038.1 PREDICTED: auxin response factor 2-like [Vigna ra... 57 5e-07 XP_016206017.1 PREDICTED: auxin response factor 4-like [Arachis ... 56 9e-07 XP_007163052.1 hypothetical protein PHAVU_001G202000g [Phaseolus... 55 1e-06 XP_015968922.1 PREDICTED: auxin response factor 4-like [Arachis ... 55 2e-06 KRH68102.1 hypothetical protein GLYMA_03G208800 [Glycine max] 54 3e-06 KHN28241.1 Auxin response factor 7, partial [Glycine soja] 54 3e-06 XP_006577121.2 PREDICTED: auxin response factor 23-like [Glycine... 54 3e-06 XP_017417210.1 PREDICTED: auxin response factor 23-like [Vigna a... 54 4e-06 >KYP71628.1 Auxin response factor 7 [Cajanus cajan] Length = 658 Score = 61.2 bits (147), Expect = 1e-08 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 1 DMMIFGDYPWQDFQSMVQKMIICPKDGTNVPNP 99 DMM+ GDYPWQDF MVQKMIICPKDG N NP Sbjct: 617 DMMLLGDYPWQDFLGMVQKMIICPKDGVNNFNP 649 >XP_006604696.1 PREDICTED: auxin response factor 2-like [Glycine max] XP_006604697.1 PREDICTED: auxin response factor 2-like [Glycine max] KRG96367.1 hypothetical protein GLYMA_19G206100 [Glycine max] Length = 677 Score = 58.9 bits (141), Expect = 8e-08 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 1 DMMIFGDYPWQDFQSMVQKMIICPKDGTNVPNP 99 DMM GDYPWQDFQ +VQKMIICPK+GTN P Sbjct: 636 DMMQLGDYPWQDFQGVVQKMIICPKEGTNNIKP 668 >XP_014495038.1 PREDICTED: auxin response factor 2-like [Vigna radiata var. radiata] Length = 616 Score = 56.6 bits (135), Expect = 5e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = +1 Query: 1 DMMIFGDYPWQDFQSMVQKMIICPKDGTNVPNP 99 DMM DYPWQDFQ MVQKMIIC KDG N NP Sbjct: 575 DMMFLRDYPWQDFQCMVQKMIICQKDGINNLNP 607 >XP_016206017.1 PREDICTED: auxin response factor 4-like [Arachis ipaensis] Length = 686 Score = 55.8 bits (133), Expect = 9e-07 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +1 Query: 1 DMMIFGDYPWQDFQSMVQKMIICPKDGTNVPNP 99 D+M+ GD+PWQDF+SMVQKMII PKD N P+P Sbjct: 645 DIMLLGDFPWQDFRSMVQKMIIRPKDAINNPSP 677 >XP_007163052.1 hypothetical protein PHAVU_001G202000g [Phaseolus vulgaris] ESW35046.1 hypothetical protein PHAVU_001G202000g [Phaseolus vulgaris] Length = 667 Score = 55.5 bits (132), Expect = 1e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = +1 Query: 1 DMMIFGDYPWQDFQSMVQKMIICPKDGTNVPNP 99 DMM DYPWQDFQ +VQKMIIC KDG N NP Sbjct: 626 DMMFLRDYPWQDFQCVVQKMIICQKDGINSLNP 658 >XP_015968922.1 PREDICTED: auxin response factor 4-like [Arachis duranensis] Length = 686 Score = 54.7 bits (130), Expect = 2e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +1 Query: 1 DMMIFGDYPWQDFQSMVQKMIICPKDGTNVPNP 99 D+++ GD+PWQDF+SMVQKMII PKD N P+P Sbjct: 645 DILLLGDFPWQDFRSMVQKMIIRPKDAINNPSP 677 >KRH68102.1 hypothetical protein GLYMA_03G208800 [Glycine max] Length = 590 Score = 54.3 bits (129), Expect = 3e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +1 Query: 1 DMMIFGDYPWQDFQSMVQKMIICPKDGTNVPNP 99 DMM GDYPWQDF +VQKMIICPK+GT+ P Sbjct: 552 DMMQLGDYPWQDFLGVVQKMIICPKEGTDNLKP 584 >KHN28241.1 Auxin response factor 7, partial [Glycine soja] Length = 651 Score = 54.3 bits (129), Expect = 3e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +1 Query: 1 DMMIFGDYPWQDFQSMVQKMIICPKDGTNVPNP 99 DMM GDYPWQDF +VQKMIICPK+GT+ P Sbjct: 613 DMMQLGDYPWQDFLGVVQKMIICPKEGTDNLKP 645 >XP_006577121.2 PREDICTED: auxin response factor 23-like [Glycine max] Length = 676 Score = 54.3 bits (129), Expect = 3e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +1 Query: 1 DMMIFGDYPWQDFQSMVQKMIICPKDGTNVPNP 99 DMM GDYPWQDF +VQKMIICPK+GT+ P Sbjct: 638 DMMQLGDYPWQDFLGVVQKMIICPKEGTDNLKP 670 >XP_017417210.1 PREDICTED: auxin response factor 23-like [Vigna angularis] XP_017417211.1 PREDICTED: auxin response factor 23-like [Vigna angularis] BAT86359.1 hypothetical protein VIGAN_04399900 [Vigna angularis var. angularis] Length = 670 Score = 53.9 bits (128), Expect = 4e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +1 Query: 1 DMMIFGDYPWQDFQSMVQKMIICPKDGTNVPNP 99 DMM DYPWQDFQ MVQKMIIC K G N NP Sbjct: 629 DMMFLRDYPWQDFQCMVQKMIICQKHGINNLNP 661