BLASTX nr result
ID: Glycyrrhiza33_contig00013065
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00013065 (315 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003518027.1 PREDICTED: succinate dehydrogenase [ubiquinone] f... 57 3e-07 >XP_003518027.1 PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial [Glycine max] KRH69929.1 hypothetical protein GLYMA_02G057400 [Glycine max] Length = 634 Score = 57.0 bits (136), Expect = 3e-07 Identities = 29/34 (85%), Positives = 29/34 (85%) Frame = +1 Query: 211 MWRCVARVATRVQASERSNPNRQPLRSHISRFFS 312 MWRCVAR A RV ASERS PN QPLRSHISRFFS Sbjct: 1 MWRCVAR-AIRVPASERSIPNHQPLRSHISRFFS 33