BLASTX nr result
ID: Glycyrrhiza33_contig00013042
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00013042 (423 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004502819.1 PREDICTED: uncharacterized protein LOC101505139 [... 55 5e-07 XP_003526797.1 PREDICTED: uncharacterized protein LOC100777110 [... 51 6e-06 >XP_004502819.1 PREDICTED: uncharacterized protein LOC101505139 [Cicer arietinum] Length = 107 Score = 54.7 bits (130), Expect = 5e-07 Identities = 30/54 (55%), Positives = 35/54 (64%) Frame = +1 Query: 181 YLNEVESAGSSSNSPHGGGFDVDGLETEPRR*TGHSLNLKSQISVAKENPRSTP 342 YLNEVES G N+P GGGFDV GL T+ +R TGH KSQ S AK+ + P Sbjct: 32 YLNEVESPGGGGNAPQGGGFDVGGLNTKLQRQTGHF--PKSQKSDAKKRTLAAP 83 >XP_003526797.1 PREDICTED: uncharacterized protein LOC100777110 [Glycine max] Length = 66 Score = 50.8 bits (120), Expect = 6e-06 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = +1 Query: 175 EVYLNEVESAGSSSNSPHGGGFDVDGLETEPR 270 +V LNEVESA N+P GGGFDV GLETEPR Sbjct: 34 DVNLNEVESASGGGNAPQGGGFDVGGLETEPR 65