BLASTX nr result
ID: Glycyrrhiza33_contig00012450
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00012450 (427 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016165756.1 PREDICTED: leucine-rich repeat extensin-like prot... 55 8e-07 >XP_016165756.1 PREDICTED: leucine-rich repeat extensin-like protein 5 [Arachis ipaensis] Length = 165 Score = 55.5 bits (132), Expect = 8e-07 Identities = 31/52 (59%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = -1 Query: 337 QPQPTVISGPHDXXXXXXXXYASGASSLS-IHAPFFVFLFLFLIGYYSIVGK 185 + +PTVISGPHD Y+S ASSLS HAPFF+ L LFL+GY+S+VGK Sbjct: 115 EAEPTVISGPHDYYYPYYYFYSSCASSLSNHHAPFFI-LLLFLVGYFSLVGK 165