BLASTX nr result
ID: Glycyrrhiza33_contig00011058
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00011058 (383 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007157587.1 hypothetical protein PHAVU_002G081700g [Phaseolus... 85 1e-18 XP_007135071.1 hypothetical protein PHAVU_010G099000g [Phaseolus... 88 8e-18 GAU28674.1 hypothetical protein TSUD_159560, partial [Trifolium ... 87 2e-17 XP_003623963.2 RNA polymerase II transcription mediators protein... 87 2e-17 XP_004492731.1 PREDICTED: mediator of RNA polymerase II transcri... 87 2e-17 ABD32834.1 2-oxo acid dehydrogenase, lipoyl-binding site [Medica... 87 2e-17 XP_017408362.1 PREDICTED: mediator of RNA polymerase II transcri... 86 4e-17 KHN42198.1 Putative mediator of RNA polymerase II transcription ... 86 4e-17 XP_006576321.1 PREDICTED: mediator of RNA polymerase II transcri... 86 4e-17 XP_019461031.1 PREDICTED: mediator of RNA polymerase II transcri... 86 5e-17 KHN26965.1 Putative mediator of RNA polymerase II transcription ... 86 5e-17 XP_014516295.1 PREDICTED: mediator of RNA polymerase II transcri... 86 5e-17 XP_006583297.1 PREDICTED: mediator of RNA polymerase II transcri... 86 5e-17 XP_019461030.1 PREDICTED: mediator of RNA polymerase II transcri... 86 5e-17 XP_019428546.1 PREDICTED: mediator of RNA polymerase II transcri... 84 2e-16 XP_019434667.1 PREDICTED: mediator of RNA polymerase II transcri... 84 2e-16 OIV89417.1 hypothetical protein TanjilG_21911 [Lupinus angustifo... 84 2e-16 XP_004510784.1 PREDICTED: mediator of RNA polymerase II transcri... 84 3e-16 XP_014497649.1 PREDICTED: mediator of RNA polymerase II transcri... 83 4e-16 XP_014497648.1 PREDICTED: mediator of RNA polymerase II transcri... 83 4e-16 >XP_007157587.1 hypothetical protein PHAVU_002G081700g [Phaseolus vulgaris] ESW29581.1 hypothetical protein PHAVU_002G081700g [Phaseolus vulgaris] Length = 132 Score = 84.7 bits (208), Expect = 1e-18 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = -1 Query: 137 ISLTQIPHFNKTIVLNCKEAIRKRLRAINESRAQKRKAGQVYGVA 3 ISL Q+PHFNK +VLNCKEAIRKRLRAINESRAQKRK GQVYGVA Sbjct: 6 ISLNQVPHFNKNVVLNCKEAIRKRLRAINESRAQKRKVGQVYGVA 50 >XP_007135071.1 hypothetical protein PHAVU_010G099000g [Phaseolus vulgaris] ESW07065.1 hypothetical protein PHAVU_010G099000g [Phaseolus vulgaris] Length = 2215 Score = 88.2 bits (217), Expect = 8e-18 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -1 Query: 137 ISLTQIPHFNKTIVLNCKEAIRKRLRAINESRAQKRKAGQVYGVA 3 ISLTQ+PHFNK +VLNCKEAIRKRLRAINESRAQKRKAGQVYGVA Sbjct: 103 ISLTQVPHFNKNVVLNCKEAIRKRLRAINESRAQKRKAGQVYGVA 147 >GAU28674.1 hypothetical protein TSUD_159560, partial [Trifolium subterraneum] Length = 545 Score = 87.0 bits (214), Expect = 2e-17 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -1 Query: 137 ISLTQIPHFNKTIVLNCKEAIRKRLRAINESRAQKRKAGQVYGVA 3 I LTQIPHFNKTIVLNCKEAIRKRLRAINESR QKRKAGQVYGVA Sbjct: 101 ILLTQIPHFNKTIVLNCKEAIRKRLRAINESRVQKRKAGQVYGVA 145 >XP_003623963.2 RNA polymerase II transcription mediators protein [Medicago truncatula] AES80181.2 RNA polymerase II transcription mediators protein [Medicago truncatula] Length = 2257 Score = 87.0 bits (214), Expect = 2e-17 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -1 Query: 137 ISLTQIPHFNKTIVLNCKEAIRKRLRAINESRAQKRKAGQVYGVA 3 I LTQIPHFNKTIVLNCKEAIRKRLRAINESR QKRKAGQVYGVA Sbjct: 104 ILLTQIPHFNKTIVLNCKEAIRKRLRAINESRVQKRKAGQVYGVA 148 >XP_004492731.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X1 [Cicer arietinum] XP_012569136.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X1 [Cicer arietinum] Length = 2258 Score = 87.0 bits (214), Expect = 2e-17 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -1 Query: 137 ISLTQIPHFNKTIVLNCKEAIRKRLRAINESRAQKRKAGQVYGVA 3 I LTQIPHFNKTIVLNCKEAIRKRLRAINESR QKRKAGQVYGVA Sbjct: 103 ILLTQIPHFNKTIVLNCKEAIRKRLRAINESRVQKRKAGQVYGVA 147 >ABD32834.1 2-oxo acid dehydrogenase, lipoyl-binding site [Medicago truncatula] Length = 2270 Score = 87.0 bits (214), Expect = 2e-17 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -1 Query: 137 ISLTQIPHFNKTIVLNCKEAIRKRLRAINESRAQKRKAGQVYGVA 3 I LTQIPHFNKTIVLNCKEAIRKRLRAINESR QKRKAGQVYGVA Sbjct: 104 ILLTQIPHFNKTIVLNCKEAIRKRLRAINESRVQKRKAGQVYGVA 148 >XP_017408362.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12 [Vigna angularis] KOM27998.1 hypothetical protein LR48_Vigan477s002500 [Vigna angularis] BAT97947.1 hypothetical protein VIGAN_09153900 [Vigna angularis var. angularis] Length = 2219 Score = 86.3 bits (212), Expect = 4e-17 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -1 Query: 137 ISLTQIPHFNKTIVLNCKEAIRKRLRAINESRAQKRKAGQVYGVA 3 ISLTQ+PHFNK +VL+CKEAIRKRLRAINESRAQKRKAGQVYGVA Sbjct: 103 ISLTQVPHFNKNVVLDCKEAIRKRLRAINESRAQKRKAGQVYGVA 147 >KHN42198.1 Putative mediator of RNA polymerase II transcription subunit 12 [Glycine soja] Length = 2227 Score = 86.3 bits (212), Expect = 4e-17 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -1 Query: 137 ISLTQIPHFNKTIVLNCKEAIRKRLRAINESRAQKRKAGQVYGVA 3 ISLTQ+PHFNK IVL CKEAIRKRLRAINESRAQKRKAGQVYGVA Sbjct: 103 ISLTQVPHFNKNIVLKCKEAIRKRLRAINESRAQKRKAGQVYGVA 147 >XP_006576321.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Glycine max] XP_014628901.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Glycine max] XP_014628902.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Glycine max] XP_014628903.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Glycine max] KRH65041.1 hypothetical protein GLYMA_03G009200 [Glycine max] KRH65042.1 hypothetical protein GLYMA_03G009200 [Glycine max] KRH65043.1 hypothetical protein GLYMA_03G009200 [Glycine max] Length = 2227 Score = 86.3 bits (212), Expect = 4e-17 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -1 Query: 137 ISLTQIPHFNKTIVLNCKEAIRKRLRAINESRAQKRKAGQVYGVA 3 ISLTQ+PHFNK IVL CKEAIRKRLRAINESRAQKRKAGQVYGVA Sbjct: 103 ISLTQVPHFNKNIVLKCKEAIRKRLRAINESRAQKRKAGQVYGVA 147 >XP_019461031.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X2 [Lupinus angustifolius] Length = 2096 Score = 85.9 bits (211), Expect = 5e-17 Identities = 41/44 (93%), Positives = 44/44 (100%) Frame = -1 Query: 137 ISLTQIPHFNKTIVLNCKEAIRKRLRAINESRAQKRKAGQVYGV 6 ISLTQ+P+FNKT+VLNCKEAIRKRLRAINESRAQKRKAGQVYGV Sbjct: 104 ISLTQVPNFNKTVVLNCKEAIRKRLRAINESRAQKRKAGQVYGV 147 >KHN26965.1 Putative mediator of RNA polymerase II transcription subunit 12 [Glycine soja] Length = 2139 Score = 85.9 bits (211), Expect = 5e-17 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -1 Query: 137 ISLTQIPHFNKTIVLNCKEAIRKRLRAINESRAQKRKAGQVYGVA 3 ISLTQ+PHFNK +VL+CKEAIRKRLRAINESRAQKRKAGQVYGVA Sbjct: 47 ISLTQVPHFNKKVVLSCKEAIRKRLRAINESRAQKRKAGQVYGVA 91 >XP_014516295.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12 [Vigna radiata var. radiata] Length = 2219 Score = 85.9 bits (211), Expect = 5e-17 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -1 Query: 137 ISLTQIPHFNKTIVLNCKEAIRKRLRAINESRAQKRKAGQVYGVA 3 ISLTQ+PHFNK +VL CKEAIRKRLRAINESRAQKRKAGQVYGVA Sbjct: 103 ISLTQVPHFNKNVVLTCKEAIRKRLRAINESRAQKRKAGQVYGVA 147 >XP_006583297.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Glycine max] XP_006583298.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Glycine max] KRH48138.1 hypothetical protein GLYMA_07G070700 [Glycine max] Length = 2222 Score = 85.9 bits (211), Expect = 5e-17 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -1 Query: 137 ISLTQIPHFNKTIVLNCKEAIRKRLRAINESRAQKRKAGQVYGVA 3 ISLTQ+PHFNK +VL+CKEAIRKRLRAINESRAQKRKAGQVYGVA Sbjct: 103 ISLTQVPHFNKKVVLSCKEAIRKRLRAINESRAQKRKAGQVYGVA 147 >XP_019461030.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X1 [Lupinus angustifolius] OIW02042.1 hypothetical protein TanjilG_21091 [Lupinus angustifolius] Length = 2240 Score = 85.9 bits (211), Expect = 5e-17 Identities = 41/44 (93%), Positives = 44/44 (100%) Frame = -1 Query: 137 ISLTQIPHFNKTIVLNCKEAIRKRLRAINESRAQKRKAGQVYGV 6 ISLTQ+P+FNKT+VLNCKEAIRKRLRAINESRAQKRKAGQVYGV Sbjct: 104 ISLTQVPNFNKTVVLNCKEAIRKRLRAINESRAQKRKAGQVYGV 147 >XP_019428546.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Lupinus angustifolius] XP_019428554.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Lupinus angustifolius] XP_019428562.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Lupinus angustifolius] OIW16839.1 hypothetical protein TanjilG_06879 [Lupinus angustifolius] Length = 2228 Score = 84.3 bits (207), Expect = 2e-16 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -1 Query: 137 ISLTQIPHFNKTIVLNCKEAIRKRLRAINESRAQKRKAGQVYGVA 3 ISLTQ+ +FNKT+VLNCKEAIRKRLRAINESRAQKRKAGQVYGVA Sbjct: 103 ISLTQVSNFNKTVVLNCKEAIRKRLRAINESRAQKRKAGQVYGVA 147 >XP_019434667.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12 [Lupinus angustifolius] XP_019434668.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12 [Lupinus angustifolius] Length = 2244 Score = 84.3 bits (207), Expect = 2e-16 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -1 Query: 137 ISLTQIPHFNKTIVLNCKEAIRKRLRAINESRAQKRKAGQVYGVA 3 ISLTQ P+FNKT+VLNCKEAIRKRLRAINESRAQKRKAGQVYG A Sbjct: 104 ISLTQAPNFNKTVVLNCKEAIRKRLRAINESRAQKRKAGQVYGAA 148 >OIV89417.1 hypothetical protein TanjilG_21911 [Lupinus angustifolius] Length = 2271 Score = 84.3 bits (207), Expect = 2e-16 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -1 Query: 137 ISLTQIPHFNKTIVLNCKEAIRKRLRAINESRAQKRKAGQVYGVA 3 ISLTQ P+FNKT+VLNCKEAIRKRLRAINESRAQKRKAGQVYG A Sbjct: 104 ISLTQAPNFNKTVVLNCKEAIRKRLRAINESRAQKRKAGQVYGAA 148 >XP_004510784.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12 [Cicer arietinum] XP_012574178.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12 [Cicer arietinum] Length = 2223 Score = 83.6 bits (205), Expect = 3e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -1 Query: 137 ISLTQIPHFNKTIVLNCKEAIRKRLRAINESRAQKRKAGQVYGV 6 ISLTQ+PHFNKT+V NCKEAI+KRLRAINESRAQKRKAGQ+YGV Sbjct: 102 ISLTQVPHFNKTVVHNCKEAIKKRLRAINESRAQKRKAGQLYGV 145 >XP_014497649.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X2 [Vigna radiata var. radiata] Length = 2216 Score = 83.2 bits (204), Expect = 4e-16 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -1 Query: 137 ISLTQIPHFNKTIVLNCKEAIRKRLRAINESRAQKRKAGQVYGVA 3 ISLTQ+P+FNK +VLNCKEAIRKRLRAINESR QKRKAGQVYGVA Sbjct: 61 ISLTQVPNFNKGVVLNCKEAIRKRLRAINESRVQKRKAGQVYGVA 105 >XP_014497648.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X1 [Vigna radiata var. radiata] Length = 2258 Score = 83.2 bits (204), Expect = 4e-16 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -1 Query: 137 ISLTQIPHFNKTIVLNCKEAIRKRLRAINESRAQKRKAGQVYGVA 3 ISLTQ+P+FNK +VLNCKEAIRKRLRAINESR QKRKAGQVYGVA Sbjct: 103 ISLTQVPNFNKGVVLNCKEAIRKRLRAINESRVQKRKAGQVYGVA 147