BLASTX nr result
ID: Glycyrrhiza33_contig00009980
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00009980 (305 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP73379.1 DNA/RNA-binding protein KIN17 [Cajanus cajan] 72 9e-13 ONI12055.1 hypothetical protein PRUPE_4G141400 [Prunus persica] ... 69 2e-12 XP_007142247.1 hypothetical protein PHAVU_008G264800g [Phaseolus... 71 3e-12 XP_019435380.1 PREDICTED: DNA/RNA-binding protein KIN17 [Lupinus... 70 4e-12 XP_014503521.1 PREDICTED: DNA/RNA-binding protein KIN17-like [Vi... 70 4e-12 XP_007155366.1 hypothetical protein PHAVU_003G195200g [Phaseolus... 70 4e-12 CDY08243.1 BnaA05g13760D [Brassica napus] 67 5e-12 XP_010111141.1 hypothetical protein L484_010755 [Morus notabilis... 70 5e-12 XP_011085443.1 PREDICTED: DNA/RNA-binding protein KIN17 [Sesamum... 70 6e-12 GAU30717.1 hypothetical protein TSUD_39410 [Trifolium subterraneum] 68 8e-12 CDP04618.1 unnamed protein product [Coffea canephora] 70 8e-12 XP_004491366.1 PREDICTED: DNA/RNA-binding protein KIN17-like [Ci... 70 8e-12 XP_015973313.1 PREDICTED: DNA/RNA-binding protein KIN17 [Arachis... 70 8e-12 XP_012568664.1 PREDICTED: DNA/RNA-binding protein KIN17-like [Ci... 69 8e-12 ONI36525.1 hypothetical protein PRUPE_1G588200 [Prunus persica] ... 69 9e-12 GAU12412.1 hypothetical protein TSUD_253630 [Trifolium subterran... 69 9e-12 CDP17951.1 unnamed protein product [Coffea canephora] 69 1e-11 XP_003617488.1 DNA/RNA-binding protein Kin17, motif protein [Med... 69 1e-11 XP_017430865.1 PREDICTED: DNA/RNA-binding protein KIN17-like [Vi... 69 1e-11 OMO58513.1 hypothetical protein COLO4_34579 [Corchorus olitorius] 69 1e-11 >KYP73379.1 DNA/RNA-binding protein KIN17 [Cajanus cajan] Length = 398 Score = 72.4 bits (176), Expect = 9e-13 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -2 Query: 304 VDTDKFCAKVQIEKGPYDGRILKAVEYEDICKVA 203 VDTDKFCAKVQIEKGPYDGR+LKA+EYEDICKVA Sbjct: 365 VDTDKFCAKVQIEKGPYDGRVLKAMEYEDICKVA 398 >ONI12055.1 hypothetical protein PRUPE_4G141400 [Prunus persica] ONI12056.1 hypothetical protein PRUPE_4G141400 [Prunus persica] ONI12057.1 hypothetical protein PRUPE_4G141400 [Prunus persica] Length = 165 Score = 68.6 bits (166), Expect = 2e-12 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 304 VDTDKFCAKVQIEKGPYDGRILKAVEYEDICKVA 203 VDTDKFCAKVQIEKG YDGR+LKAVEYEDICK+A Sbjct: 132 VDTDKFCAKVQIEKGVYDGRLLKAVEYEDICKLA 165 >XP_007142247.1 hypothetical protein PHAVU_008G264800g [Phaseolus vulgaris] ESW14241.1 hypothetical protein PHAVU_008G264800g [Phaseolus vulgaris] Length = 396 Score = 70.9 bits (172), Expect = 3e-12 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 304 VDTDKFCAKVQIEKGPYDGRILKAVEYEDICKVA 203 VDTD FCAKVQIEKGPYDGRILKA+EYEDICKVA Sbjct: 363 VDTDNFCAKVQIEKGPYDGRILKAMEYEDICKVA 396 >XP_019435380.1 PREDICTED: DNA/RNA-binding protein KIN17 [Lupinus angustifolius] OIW16330.1 hypothetical protein TanjilG_19046 [Lupinus angustifolius] Length = 398 Score = 70.5 bits (171), Expect = 4e-12 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 304 VDTDKFCAKVQIEKGPYDGRILKAVEYEDICKVA 203 VDTD FCAKVQ+EKGPYDGR+LKAVEYEDICK+A Sbjct: 365 VDTDHFCAKVQVEKGPYDGRVLKAVEYEDICKIA 398 >XP_014503521.1 PREDICTED: DNA/RNA-binding protein KIN17-like [Vigna radiata var. radiata] Length = 398 Score = 70.5 bits (171), Expect = 4e-12 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 304 VDTDKFCAKVQIEKGPYDGRILKAVEYEDICKVA 203 VDTD FCAKVQIEKGPYDGR+LKA+EYEDICKVA Sbjct: 365 VDTDNFCAKVQIEKGPYDGRVLKAMEYEDICKVA 398 >XP_007155366.1 hypothetical protein PHAVU_003G195200g [Phaseolus vulgaris] ESW27360.1 hypothetical protein PHAVU_003G195200g [Phaseolus vulgaris] Length = 399 Score = 70.5 bits (171), Expect = 4e-12 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 304 VDTDKFCAKVQIEKGPYDGRILKAVEYEDICKVA 203 VDTD FCAKVQIEKGPYDGR+LKA+EYEDICKVA Sbjct: 366 VDTDNFCAKVQIEKGPYDGRVLKAMEYEDICKVA 399 >CDY08243.1 BnaA05g13760D [Brassica napus] Length = 121 Score = 66.6 bits (161), Expect = 5e-12 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -2 Query: 304 VDTDKFCAKVQIEKGPYDGRILKAVEYEDICKVA 203 VDTDKFCAKVQIEKG Y+GR++KA+EYED+CK+A Sbjct: 88 VDTDKFCAKVQIEKGVYEGRVIKAIEYEDVCKIA 121 >XP_010111141.1 hypothetical protein L484_010755 [Morus notabilis] EXC30506.1 hypothetical protein L484_010755 [Morus notabilis] Length = 368 Score = 70.1 bits (170), Expect = 5e-12 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 304 VDTDKFCAKVQIEKGPYDGRILKAVEYEDICKVAQ 200 VDTDKFCAKVQIEKG YDGR+LKAVEYEDICK+ Q Sbjct: 334 VDTDKFCAKVQIEKGVYDGRVLKAVEYEDICKIVQ 368 >XP_011085443.1 PREDICTED: DNA/RNA-binding protein KIN17 [Sesamum indicum] Length = 399 Score = 70.1 bits (170), Expect = 6e-12 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -2 Query: 304 VDTDKFCAKVQIEKGPYDGRILKAVEYEDICKVAQ 200 +DTDKFCAKVQIEKG YDGR+LKAVEYEDICK+AQ Sbjct: 365 IDTDKFCAKVQIEKGIYDGRVLKAVEYEDICKLAQ 399 >GAU30717.1 hypothetical protein TSUD_39410 [Trifolium subterraneum] Length = 214 Score = 68.2 bits (165), Expect = 8e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 304 VDTDKFCAKVQIEKGPYDGRILKAVEYEDICKVA 203 VDTD FCAKVQIEKG YDGR+LKAVEYEDICKVA Sbjct: 181 VDTDHFCAKVQIEKGAYDGRVLKAVEYEDICKVA 214 >CDP04618.1 unnamed protein product [Coffea canephora] Length = 391 Score = 69.7 bits (169), Expect = 8e-12 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -2 Query: 304 VDTDKFCAKVQIEKGPYDGRILKAVEYEDICKVAQ 200 VDTDKFCAKVQIEKG YDGR++KAVEYEDICK+AQ Sbjct: 357 VDTDKFCAKVQIEKGIYDGRVIKAVEYEDICKLAQ 391 >XP_004491366.1 PREDICTED: DNA/RNA-binding protein KIN17-like [Cicer arietinum] Length = 397 Score = 69.7 bits (169), Expect = 8e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 304 VDTDKFCAKVQIEKGPYDGRILKAVEYEDICKVA 203 VDTD FCAKVQIEKGPYDGR+LKAVEYEDICK A Sbjct: 364 VDTDHFCAKVQIEKGPYDGRVLKAVEYEDICKAA 397 >XP_015973313.1 PREDICTED: DNA/RNA-binding protein KIN17 [Arachis duranensis] Length = 401 Score = 69.7 bits (169), Expect = 8e-12 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 304 VDTDKFCAKVQIEKGPYDGRILKAVEYEDICKVAQ 200 VDTD FCAKVQIEKG YDGR+LKAVEYEDICK+AQ Sbjct: 367 VDTDHFCAKVQIEKGAYDGRVLKAVEYEDICKIAQ 401 >XP_012568664.1 PREDICTED: DNA/RNA-binding protein KIN17-like [Cicer arietinum] Length = 244 Score = 68.6 bits (166), Expect = 8e-12 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 304 VDTDKFCAKVQIEKGPYDGRILKAVEYEDICKVA 203 VDTD FCAKVQI+KGPYDGR+LKAVEYEDICK+A Sbjct: 211 VDTDHFCAKVQIKKGPYDGRVLKAVEYEDICKLA 244 >ONI36525.1 hypothetical protein PRUPE_1G588200 [Prunus persica] ONI36526.1 hypothetical protein PRUPE_1G588200 [Prunus persica] Length = 286 Score = 68.9 bits (167), Expect = 9e-12 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 304 VDTDKFCAKVQIEKGPYDGRILKAVEYEDICKVA 203 VDTDKFCAKVQIEKG YDGR+LKAVEYEDICK+A Sbjct: 253 VDTDKFCAKVQIEKGVYDGRVLKAVEYEDICKLA 286 >GAU12412.1 hypothetical protein TSUD_253630 [Trifolium subterraneum] Length = 345 Score = 69.3 bits (168), Expect = 9e-12 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 304 VDTDKFCAKVQIEKGPYDGRILKAVEYEDICKVA 203 VDTD+FCAKVQIEKG YDGR+LKAVEYEDICKVA Sbjct: 312 VDTDRFCAKVQIEKGAYDGRVLKAVEYEDICKVA 345 >CDP17951.1 unnamed protein product [Coffea canephora] Length = 385 Score = 69.3 bits (168), Expect = 1e-11 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -2 Query: 304 VDTDKFCAKVQIEKGPYDGRILKAVEYEDICKVAQ 200 VDTDKFCAKVQIEKG YDGR++KA+EYEDICK+AQ Sbjct: 351 VDTDKFCAKVQIEKGIYDGRVIKAIEYEDICKLAQ 385 >XP_003617488.1 DNA/RNA-binding protein Kin17, motif protein [Medicago truncatula] ACJ85115.1 unknown [Medicago truncatula] AET00447.1 DNA/RNA-binding protein Kin17, motif protein [Medicago truncatula] AFK36597.1 unknown [Medicago truncatula] Length = 398 Score = 69.3 bits (168), Expect = 1e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 304 VDTDKFCAKVQIEKGPYDGRILKAVEYEDICKVA 203 VDTD+FCAKVQIEKG YDGR+LKAVEYEDICKVA Sbjct: 365 VDTDRFCAKVQIEKGAYDGRVLKAVEYEDICKVA 398 >XP_017430865.1 PREDICTED: DNA/RNA-binding protein KIN17-like [Vigna angularis] KOM46494.1 hypothetical protein LR48_Vigan07g019800 [Vigna angularis] BAT80741.1 hypothetical protein VIGAN_03034000 [Vigna angularis var. angularis] Length = 399 Score = 69.3 bits (168), Expect = 1e-11 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 304 VDTDKFCAKVQIEKGPYDGRILKAVEYEDICKVA 203 VDTD FCAKVQIEKGPYDGR+LKA+EYEDICK+A Sbjct: 366 VDTDNFCAKVQIEKGPYDGRVLKAMEYEDICKLA 399 >OMO58513.1 hypothetical protein COLO4_34579 [Corchorus olitorius] Length = 350 Score = 68.9 bits (167), Expect = 1e-11 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 304 VDTDKFCAKVQIEKGPYDGRILKAVEYEDICKVA 203 VDTDKFCAKVQIEKG YDGR++KA+EYEDICKVA Sbjct: 317 VDTDKFCAKVQIEKGVYDGRVIKAIEYEDICKVA 350