BLASTX nr result
ID: Glycyrrhiza33_contig00009849
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00009849 (486 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN41889.1 26S proteasome non-ATPase regulatory subunit 4 [Glyci... 72 4e-12 KRH76644.1 hypothetical protein GLYMA_01G165100 [Glycine max] 72 4e-12 XP_017408428.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 73 4e-12 XP_014519217.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 73 4e-12 XP_017408427.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 73 4e-12 XP_017408426.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 73 4e-12 XP_017408425.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 73 4e-12 XP_014519216.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 73 4e-12 XP_014519215.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 73 4e-12 XP_014519213.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 73 4e-12 XP_006573551.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 72 5e-12 XP_014631176.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 72 6e-12 KRH76643.1 hypothetical protein GLYMA_01G165100 [Glycine max] 72 6e-12 KYP66600.1 26S proteasome non-ATPase regulatory subunit 4, parti... 72 6e-12 KRH28809.1 hypothetical protein GLYMA_11G078100 [Glycine max] 72 6e-12 XP_003517168.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 72 6e-12 KYP55024.1 26S proteasome non-ATPase regulatory subunit 4 [Cajan... 72 1e-11 XP_007156172.1 hypothetical protein PHAVU_003G264300g [Phaseolus... 72 1e-11 KRH69765.1 hypothetical protein GLYMA_02G046900 [Glycine max] 72 1e-11 XP_014509036.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 72 1e-11 >KHN41889.1 26S proteasome non-ATPase regulatory subunit 4 [Glycine soja] Length = 307 Score = 72.4 bits (176), Expect = 4e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 485 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPSDEEKK 378 GVDPNDPSVKDLLASMQNQSEPQQKN+DKPS+EE+K Sbjct: 271 GVDPNDPSVKDLLASMQNQSEPQQKNDDKPSNEEEK 306 >KRH76644.1 hypothetical protein GLYMA_01G165100 [Glycine max] Length = 321 Score = 72.4 bits (176), Expect = 4e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 485 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPSDEEKK 378 GVDPNDPSVKDLLASMQNQSEPQQKN+DKPS+EE+K Sbjct: 285 GVDPNDPSVKDLLASMQNQSEPQQKNDDKPSNEEEK 320 >XP_017408428.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X4 [Vigna angularis] Length = 395 Score = 72.8 bits (177), Expect = 4e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 485 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPSDEEKK 378 GVDPNDPSVKDLLASMQNQSEPQQKN+DKPS+EE+K Sbjct: 359 GVDPNDPSVKDLLASMQNQSEPQQKNDDKPSEEEEK 394 >XP_014519217.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X4 [Vigna radiata var. radiata] Length = 397 Score = 72.8 bits (177), Expect = 4e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 485 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPSDEEKK 378 GVDPNDPSVKDLLASMQNQSEPQQKN+DKPS+EE+K Sbjct: 361 GVDPNDPSVKDLLASMQNQSEPQQKNDDKPSEEEEK 396 >XP_017408427.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X3 [Vigna angularis] Length = 401 Score = 72.8 bits (177), Expect = 4e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 485 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPSDEEKK 378 GVDPNDPSVKDLLASMQNQSEPQQKN+DKPS+EE+K Sbjct: 365 GVDPNDPSVKDLLASMQNQSEPQQKNDDKPSEEEEK 400 >XP_017408426.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X2 [Vigna angularis] Length = 402 Score = 72.8 bits (177), Expect = 4e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 485 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPSDEEKK 378 GVDPNDPSVKDLLASMQNQSEPQQKN+DKPS+EE+K Sbjct: 366 GVDPNDPSVKDLLASMQNQSEPQQKNDDKPSEEEEK 401 >XP_017408425.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X1 [Vigna angularis] BAT99970.1 hypothetical protein VIGAN_10151700 [Vigna angularis var. angularis] Length = 403 Score = 72.8 bits (177), Expect = 4e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 485 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPSDEEKK 378 GVDPNDPSVKDLLASMQNQSEPQQKN+DKPS+EE+K Sbjct: 367 GVDPNDPSVKDLLASMQNQSEPQQKNDDKPSEEEEK 402 >XP_014519216.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X3 [Vigna radiata var. radiata] Length = 403 Score = 72.8 bits (177), Expect = 4e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 485 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPSDEEKK 378 GVDPNDPSVKDLLASMQNQSEPQQKN+DKPS+EE+K Sbjct: 367 GVDPNDPSVKDLLASMQNQSEPQQKNDDKPSEEEEK 402 >XP_014519215.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X2 [Vigna radiata var. radiata] Length = 404 Score = 72.8 bits (177), Expect = 4e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 485 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPSDEEKK 378 GVDPNDPSVKDLLASMQNQSEPQQKN+DKPS+EE+K Sbjct: 368 GVDPNDPSVKDLLASMQNQSEPQQKNDDKPSEEEEK 403 >XP_014519213.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X1 [Vigna radiata var. radiata] Length = 405 Score = 72.8 bits (177), Expect = 4e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 485 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPSDEEKK 378 GVDPNDPSVKDLLASMQNQSEPQQKN+DKPS+EE+K Sbjct: 369 GVDPNDPSVKDLLASMQNQSEPQQKNDDKPSEEEEK 404 >XP_006573551.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X4 [Glycine max] Length = 362 Score = 72.4 bits (176), Expect = 5e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 485 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPSDEEKK 378 GVDPNDPSVKDLLASMQNQSEPQQKN+DKPS+EE+K Sbjct: 326 GVDPNDPSVKDLLASMQNQSEPQQKNDDKPSNEEEK 361 >XP_014631176.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X2 [Glycine max] Length = 389 Score = 72.4 bits (176), Expect = 6e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 485 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPSDEEKK 378 GVDPNDPSVKDLLASMQNQSEPQQKN+DKPS+EE+K Sbjct: 353 GVDPNDPSVKDLLASMQNQSEPQQKNDDKPSNEEEK 388 >KRH76643.1 hypothetical protein GLYMA_01G165100 [Glycine max] Length = 399 Score = 72.4 bits (176), Expect = 6e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 485 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPSDEEKK 378 GVDPNDPSVKDLLASMQNQSEPQQKN+DKPS+EE+K Sbjct: 363 GVDPNDPSVKDLLASMQNQSEPQQKNDDKPSNEEEK 398 >KYP66600.1 26S proteasome non-ATPase regulatory subunit 4, partial [Cajanus cajan] Length = 405 Score = 72.4 bits (176), Expect = 6e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 485 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPSDEEKK 378 GVDPNDPSVKDLLASMQNQSEPQQKN+DKPS+EE+K Sbjct: 369 GVDPNDPSVKDLLASMQNQSEPQQKNDDKPSNEEEK 404 >KRH28809.1 hypothetical protein GLYMA_11G078100 [Glycine max] Length = 405 Score = 72.4 bits (176), Expect = 6e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 485 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPSDEEKK 378 GVDPNDPSVKDLLASMQNQSEPQQKN+DKPS+EE+K Sbjct: 369 GVDPNDPSVKDLLASMQNQSEPQQKNDDKPSNEEEK 404 >XP_003517168.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X1 [Glycine max] KRH76642.1 hypothetical protein GLYMA_01G165100 [Glycine max] Length = 405 Score = 72.4 bits (176), Expect = 6e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 485 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPSDEEKK 378 GVDPNDPSVKDLLASMQNQSEPQQKN+DKPS+EE+K Sbjct: 369 GVDPNDPSVKDLLASMQNQSEPQQKNDDKPSNEEEK 404 >KYP55024.1 26S proteasome non-ATPase regulatory subunit 4 [Cajanus cajan] Length = 383 Score = 71.6 bits (174), Expect = 1e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 485 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPSDEEKK 378 GVDPNDPSVKDLLASMQNQSEPQQKNEDKP +EE+K Sbjct: 347 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPPNEEEK 382 >XP_007156172.1 hypothetical protein PHAVU_003G264300g [Phaseolus vulgaris] ESW28166.1 hypothetical protein PHAVU_003G264300g [Phaseolus vulgaris] Length = 402 Score = 71.6 bits (174), Expect = 1e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 485 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPSDEEKK 378 GVDPNDPSVKDLLASMQNQSEPQQKNEDKP +EE+K Sbjct: 366 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPPNEEEK 401 >KRH69765.1 hypothetical protein GLYMA_02G046900 [Glycine max] Length = 403 Score = 71.6 bits (174), Expect = 1e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 485 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPSDEEKK 378 GVDPNDPSVKDLLASMQNQSEPQQKNEDKP +EE+K Sbjct: 367 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPPNEEEK 402 >XP_014509036.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Vigna radiata var. radiata] Length = 405 Score = 71.6 bits (174), Expect = 1e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 485 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPSDEEKK 378 GVDPNDPSVKDLLASMQNQSEPQQKNEDKP +EE+K Sbjct: 369 GVDPNDPSVKDLLASMQNQSEPQQKNEDKPPNEEEK 404