BLASTX nr result
ID: Glycyrrhiza33_contig00009142
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00009142 (344 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014622476.1 PREDICTED: uncharacterized protein LOC100815261 i... 154 2e-41 KHN23829.1 hypothetical protein glysoja_028122 [Glycine soja] 154 2e-41 XP_003545090.1 PREDICTED: uncharacterized protein LOC100815261 i... 154 2e-41 XP_006595682.1 PREDICTED: uncharacterized protein LOC100815261 i... 154 2e-41 KRH73930.1 hypothetical protein GLYMA_02G302000 [Glycine max] 154 3e-41 KHN43908.1 hypothetical protein glysoja_025947 [Glycine soja] 154 3e-41 XP_006575714.1 PREDICTED: uncharacterized protein LOC100819602 i... 154 3e-41 XP_006575713.1 PREDICTED: uncharacterized protein LOC100819602 i... 154 3e-41 XP_006575712.1 PREDICTED: uncharacterized protein LOC100819602 i... 154 3e-41 KYP73488.1 hypothetical protein KK1_006114 [Cajanus cajan] 152 8e-41 XP_007142439.1 hypothetical protein PHAVU_008G280600g [Phaseolus... 152 8e-41 XP_015972831.1 PREDICTED: GBF-interacting protein 1-like [Arachi... 149 2e-39 XP_016166334.1 PREDICTED: GBF-interacting protein 1-like [Arachi... 149 2e-39 XP_014504993.1 PREDICTED: uncharacterized protein LOC106765023 [... 148 2e-39 XP_017430421.1 PREDICTED: GBF-interacting protein 1-like [Vigna ... 148 2e-39 XP_012568729.1 PREDICTED: uncharacterized protein LOC101489896 i... 147 6e-39 XP_012568727.1 PREDICTED: uncharacterized protein LOC101489896 i... 147 7e-39 GAU28284.1 hypothetical protein TSUD_256120 [Trifolium subterran... 146 1e-38 XP_019435702.1 PREDICTED: GBF-interacting protein 1-like [Lupinu... 143 2e-37 XP_019426115.1 PREDICTED: GBF-interacting protein 1-like isoform... 142 3e-37 >XP_014622476.1 PREDICTED: uncharacterized protein LOC100815261 isoform X3 [Glycine max] Length = 764 Score = 154 bits (389), Expect = 2e-41 Identities = 76/80 (95%), Positives = 77/80 (96%) Frame = +2 Query: 104 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 283 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 12 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 71 Query: 284 RKKEGLSSGASEETRSKQGG 343 RKKEGLSS AS+E R KQGG Sbjct: 72 RKKEGLSSRASDEPRLKQGG 91 >KHN23829.1 hypothetical protein glysoja_028122 [Glycine soja] Length = 765 Score = 154 bits (389), Expect = 2e-41 Identities = 76/80 (95%), Positives = 77/80 (96%) Frame = +2 Query: 104 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 283 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 12 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 71 Query: 284 RKKEGLSSGASEETRSKQGG 343 RKKEGLSS AS+E R KQGG Sbjct: 72 RKKEGLSSRASDEPRLKQGG 91 >XP_003545090.1 PREDICTED: uncharacterized protein LOC100815261 isoform X2 [Glycine max] KRH14202.1 hypothetical protein GLYMA_14G012200 [Glycine max] Length = 765 Score = 154 bits (389), Expect = 2e-41 Identities = 76/80 (95%), Positives = 77/80 (96%) Frame = +2 Query: 104 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 283 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 12 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 71 Query: 284 RKKEGLSSGASEETRSKQGG 343 RKKEGLSS AS+E R KQGG Sbjct: 72 RKKEGLSSRASDEPRLKQGG 91 >XP_006595682.1 PREDICTED: uncharacterized protein LOC100815261 isoform X1 [Glycine max] KRH14203.1 hypothetical protein GLYMA_14G012200 [Glycine max] Length = 773 Score = 154 bits (389), Expect = 2e-41 Identities = 76/80 (95%), Positives = 77/80 (96%) Frame = +2 Query: 104 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 283 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 12 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 71 Query: 284 RKKEGLSSGASEETRSKQGG 343 RKKEGLSS AS+E R KQGG Sbjct: 72 RKKEGLSSRASDEPRLKQGG 91 >KRH73930.1 hypothetical protein GLYMA_02G302000 [Glycine max] Length = 760 Score = 154 bits (388), Expect = 3e-41 Identities = 75/80 (93%), Positives = 77/80 (96%) Frame = +2 Query: 104 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 283 RVPIPNNVRKIIQDIREITGKQHTDDEIYA+LRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 12 RVPIPNNVRKIIQDIREITGKQHTDDEIYAILRECSMDPNETAQKLLYLDTFHEVRRRRD 71 Query: 284 RKKEGLSSGASEETRSKQGG 343 RKKEGLSS AS+E R KQGG Sbjct: 72 RKKEGLSSRASDEPRLKQGG 91 >KHN43908.1 hypothetical protein glysoja_025947 [Glycine soja] Length = 764 Score = 154 bits (388), Expect = 3e-41 Identities = 75/80 (93%), Positives = 77/80 (96%) Frame = +2 Query: 104 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 283 RVPIPNNVRKIIQDIREITGKQHTDDEIYA+LRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 12 RVPIPNNVRKIIQDIREITGKQHTDDEIYAILRECSMDPNETAQKLLYLDTFHEVRRRRD 71 Query: 284 RKKEGLSSGASEETRSKQGG 343 RKKEGLSS AS+E R KQGG Sbjct: 72 RKKEGLSSRASDEPRLKQGG 91 >XP_006575714.1 PREDICTED: uncharacterized protein LOC100819602 isoform X3 [Glycine max] KRH73929.1 hypothetical protein GLYMA_02G302000 [Glycine max] Length = 764 Score = 154 bits (388), Expect = 3e-41 Identities = 75/80 (93%), Positives = 77/80 (96%) Frame = +2 Query: 104 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 283 RVPIPNNVRKIIQDIREITGKQHTDDEIYA+LRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 12 RVPIPNNVRKIIQDIREITGKQHTDDEIYAILRECSMDPNETAQKLLYLDTFHEVRRRRD 71 Query: 284 RKKEGLSSGASEETRSKQGG 343 RKKEGLSS AS+E R KQGG Sbjct: 72 RKKEGLSSRASDEPRLKQGG 91 >XP_006575713.1 PREDICTED: uncharacterized protein LOC100819602 isoform X2 [Glycine max] Length = 768 Score = 154 bits (388), Expect = 3e-41 Identities = 75/80 (93%), Positives = 77/80 (96%) Frame = +2 Query: 104 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 283 RVPIPNNVRKIIQDIREITGKQHTDDEIYA+LRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 12 RVPIPNNVRKIIQDIREITGKQHTDDEIYAILRECSMDPNETAQKLLYLDTFHEVRRRRD 71 Query: 284 RKKEGLSSGASEETRSKQGG 343 RKKEGLSS AS+E R KQGG Sbjct: 72 RKKEGLSSRASDEPRLKQGG 91 >XP_006575712.1 PREDICTED: uncharacterized protein LOC100819602 isoform X1 [Glycine max] Length = 772 Score = 154 bits (388), Expect = 3e-41 Identities = 75/80 (93%), Positives = 77/80 (96%) Frame = +2 Query: 104 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 283 RVPIPNNVRKIIQDIREITGKQHTDDEIYA+LRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 12 RVPIPNNVRKIIQDIREITGKQHTDDEIYAILRECSMDPNETAQKLLYLDTFHEVRRRRD 71 Query: 284 RKKEGLSSGASEETRSKQGG 343 RKKEGLSS AS+E R KQGG Sbjct: 72 RKKEGLSSRASDEPRLKQGG 91 >KYP73488.1 hypothetical protein KK1_006114 [Cajanus cajan] Length = 768 Score = 152 bits (385), Expect = 8e-41 Identities = 74/80 (92%), Positives = 78/80 (97%) Frame = +2 Query: 104 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 283 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEV+RRRD Sbjct: 11 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVKRRRD 70 Query: 284 RKKEGLSSGASEETRSKQGG 343 RKKEGL+S AS+E+R KQGG Sbjct: 71 RKKEGLTSRASDESRLKQGG 90 >XP_007142439.1 hypothetical protein PHAVU_008G280600g [Phaseolus vulgaris] ESW14433.1 hypothetical protein PHAVU_008G280600g [Phaseolus vulgaris] Length = 768 Score = 152 bits (385), Expect = 8e-41 Identities = 75/80 (93%), Positives = 76/80 (95%) Frame = +2 Query: 104 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 283 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 11 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 70 Query: 284 RKKEGLSSGASEETRSKQGG 343 RKKEGLSS S+E R KQGG Sbjct: 71 RKKEGLSSRVSDEPRIKQGG 90 >XP_015972831.1 PREDICTED: GBF-interacting protein 1-like [Arachis duranensis] Length = 775 Score = 149 bits (375), Expect = 2e-39 Identities = 72/80 (90%), Positives = 74/80 (92%) Frame = +2 Query: 104 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 283 RVPIPNNVRK I DIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 9 RVPIPNNVRKTIHDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 68 Query: 284 RKKEGLSSGASEETRSKQGG 343 RKKEG S SE++RSKQGG Sbjct: 69 RKKEGFGSRTSEDSRSKQGG 88 >XP_016166334.1 PREDICTED: GBF-interacting protein 1-like [Arachis ipaensis] Length = 776 Score = 149 bits (375), Expect = 2e-39 Identities = 72/80 (90%), Positives = 74/80 (92%) Frame = +2 Query: 104 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 283 RVPIPNNVRK I DIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 9 RVPIPNNVRKTIHDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 68 Query: 284 RKKEGLSSGASEETRSKQGG 343 RKKEG S SE++RSKQGG Sbjct: 69 RKKEGFGSRTSEDSRSKQGG 88 >XP_014504993.1 PREDICTED: uncharacterized protein LOC106765023 [Vigna radiata var. radiata] Length = 767 Score = 148 bits (374), Expect = 2e-39 Identities = 72/80 (90%), Positives = 75/80 (93%) Frame = +2 Query: 104 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 283 RVPIPNNVRK IQDIREITGKQHTDDEIYAVL+ECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 11 RVPIPNNVRKTIQDIREITGKQHTDDEIYAVLKECSMDPNETAQKLLYLDTFHEVRRRRD 70 Query: 284 RKKEGLSSGASEETRSKQGG 343 RKKEGLS+ S+E R KQGG Sbjct: 71 RKKEGLSNRVSDEPRIKQGG 90 >XP_017430421.1 PREDICTED: GBF-interacting protein 1-like [Vigna angularis] KOM46398.1 hypothetical protein LR48_Vigan07g010200 [Vigna angularis] BAT80576.1 hypothetical protein VIGAN_03016700 [Vigna angularis var. angularis] Length = 767 Score = 148 bits (374), Expect = 2e-39 Identities = 72/80 (90%), Positives = 75/80 (93%) Frame = +2 Query: 104 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 283 RVPIPNNVRK IQDIREITGKQHTDDEIYAVL+ECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 11 RVPIPNNVRKTIQDIREITGKQHTDDEIYAVLKECSMDPNETAQKLLYLDTFHEVRRRRD 70 Query: 284 RKKEGLSSGASEETRSKQGG 343 RKKEGLS+ S+E R KQGG Sbjct: 71 RKKEGLSNRVSDEPRIKQGG 90 >XP_012568729.1 PREDICTED: uncharacterized protein LOC101489896 isoform X3 [Cicer arietinum] XP_012568730.1 PREDICTED: uncharacterized protein LOC101489896 isoform X4 [Cicer arietinum] Length = 742 Score = 147 bits (371), Expect = 6e-39 Identities = 72/80 (90%), Positives = 75/80 (93%) Frame = +2 Query: 104 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 283 RVPIPNNVRKII DIREITGKQHTD+EIYAVL+ECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 9 RVPIPNNVRKIIHDIREITGKQHTDEEIYAVLKECSMDPNETAQKLLYLDTFHEVRRRRD 68 Query: 284 RKKEGLSSGASEETRSKQGG 343 RKKEGL S SEE+RSKQ G Sbjct: 69 RKKEGLRSRVSEESRSKQRG 88 >XP_012568727.1 PREDICTED: uncharacterized protein LOC101489896 isoform X1 [Cicer arietinum] XP_012568728.1 PREDICTED: uncharacterized protein LOC101489896 isoform X2 [Cicer arietinum] Length = 772 Score = 147 bits (371), Expect = 7e-39 Identities = 72/80 (90%), Positives = 75/80 (93%) Frame = +2 Query: 104 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 283 RVPIPNNVRKII DIREITGKQHTD+EIYAVL+ECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 9 RVPIPNNVRKIIHDIREITGKQHTDEEIYAVLKECSMDPNETAQKLLYLDTFHEVRRRRD 68 Query: 284 RKKEGLSSGASEETRSKQGG 343 RKKEGL S SEE+RSKQ G Sbjct: 69 RKKEGLRSRVSEESRSKQRG 88 >GAU28284.1 hypothetical protein TSUD_256120 [Trifolium subterraneum] Length = 772 Score = 146 bits (369), Expect = 1e-38 Identities = 71/80 (88%), Positives = 75/80 (93%) Frame = +2 Query: 104 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 283 RVPIPNNVRK IQDIREITGKQHTDDEIYAVL+ECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 9 RVPIPNNVRKTIQDIREITGKQHTDDEIYAVLKECSMDPNETAQKLLYLDTFHEVRRRRD 68 Query: 284 RKKEGLSSGASEETRSKQGG 343 +KK+GLSS SEE+RS Q G Sbjct: 69 KKKDGLSSRVSEESRSNQRG 88 >XP_019435702.1 PREDICTED: GBF-interacting protein 1-like [Lupinus angustifolius] OIW16406.1 hypothetical protein TanjilG_19122 [Lupinus angustifolius] Length = 777 Score = 143 bits (360), Expect = 2e-37 Identities = 69/79 (87%), Positives = 75/79 (94%) Frame = +2 Query: 104 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 283 RVPIP+NVRK I +IREITGKQHTDDEIYAVLR+CSMDPNETAQKLLYLDTFHEV+RRRD Sbjct: 17 RVPIPDNVRKTIHNIREITGKQHTDDEIYAVLRDCSMDPNETAQKLLYLDTFHEVKRRRD 76 Query: 284 RKKEGLSSGASEETRSKQG 340 R KEGLSS ASE++RSKQG Sbjct: 77 RNKEGLSSRASEDSRSKQG 95 >XP_019426115.1 PREDICTED: GBF-interacting protein 1-like isoform X2 [Lupinus angustifolius] Length = 763 Score = 142 bits (359), Expect = 3e-37 Identities = 70/80 (87%), Positives = 73/80 (91%) Frame = +2 Query: 104 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 283 RV IPNNVRK IQ IREITGKQHTDDEIYAVLRECSMDPN+TAQKLLYLDTFHEV RRRD Sbjct: 12 RVSIPNNVRKTIQHIREITGKQHTDDEIYAVLRECSMDPNDTAQKLLYLDTFHEVTRRRD 71 Query: 284 RKKEGLSSGASEETRSKQGG 343 RKKEGLSSG E++R KQGG Sbjct: 72 RKKEGLSSGDLEDSRMKQGG 91