BLASTX nr result
ID: Glycyrrhiza33_contig00008975
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00008975 (363 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OEL32462.1 DNA-directed RNA polymerase II subunit 1 [Dichantheli... 55 2e-06 >OEL32462.1 DNA-directed RNA polymerase II subunit 1 [Dichanthelium oligosanthes] Length = 1901 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 7/58 (12%) Frame = +1 Query: 1 PNISII*SY-------IACLQSHISWVQPNITLLQPDISIV*SYFPKLQSTVCKV*SF 153 PNI II Y IAC+Q +++W+QPNIT LQPDI+ + SYF +LQS + +V F Sbjct: 1669 PNIPIIQPYLPFIQPNIACIQPYLAWIQPNITKLQPDITKLQSYFSELQSFISQVQPF 1726