BLASTX nr result
ID: Glycyrrhiza33_contig00008728
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00008728 (343 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003620478.1 CRS1/YhbY (CRM) domain protein [Medicago truncatu... 62 5e-09 GAU22712.1 hypothetical protein TSUD_138360 [Trifolium subterran... 59 9e-08 BAU02786.1 hypothetical protein VIGAN_11236800 [Vigna angularis ... 57 4e-07 XP_017437941.1 PREDICTED: CRM-domain containing factor CFM3, chl... 57 4e-07 KOM54327.1 hypothetical protein LR48_Vigan10g021900 [Vigna angul... 57 4e-07 XP_014513697.1 PREDICTED: chloroplastic group IIA intron splicin... 55 2e-06 XP_007152752.1 hypothetical protein PHAVU_004G156500g [Phaseolus... 55 2e-06 >XP_003620478.1 CRS1/YhbY (CRM) domain protein [Medicago truncatula] AES76696.1 CRS1/YhbY (CRM) domain protein [Medicago truncatula] Length = 820 Score = 62.4 bits (150), Expect = 5e-09 Identities = 32/46 (69%), Positives = 34/46 (73%), Gaps = 4/46 (8%) Frame = +1 Query: 178 PWLTK----PKRVSESTTTEHPPHPQPVKPKNAVERIVFRLRNLGL 303 PWLTK PKRV+ES + P PQP KPKN VERIVFRLRNLGL Sbjct: 74 PWLTKNPSSPKRVTESPIKDDPFQPQPQKPKNPVERIVFRLRNLGL 119 >GAU22712.1 hypothetical protein TSUD_138360 [Trifolium subterraneum] Length = 812 Score = 58.9 bits (141), Expect = 9e-08 Identities = 32/46 (69%), Positives = 32/46 (69%), Gaps = 4/46 (8%) Frame = +1 Query: 178 PWLTK----PKRVSESTTTEHPPHPQPVKPKNAVERIVFRLRNLGL 303 PWLTK PKRVSEST E QP KPK VERIVFRLRNLGL Sbjct: 65 PWLTKTTNSPKRVSESTIKEESSQLQPDKPKTPVERIVFRLRNLGL 110 >BAU02786.1 hypothetical protein VIGAN_11236800 [Vigna angularis var. angularis] Length = 800 Score = 57.0 bits (136), Expect = 4e-07 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 4/49 (8%) Frame = +1 Query: 175 APWLTK---PKRVSESTTTEHPPH-PQPVKPKNAVERIVFRLRNLGLAS 309 APWLTK PK+V+ES T + P H P +P+NAVERIV RLRNLGL S Sbjct: 49 APWLTKSPSPKKVTESLTADDPIHRTTPKQPQNAVERIVLRLRNLGLPS 97 >XP_017437941.1 PREDICTED: CRM-domain containing factor CFM3, chloroplastic/mitochondrial-like [Vigna angularis] Length = 834 Score = 57.0 bits (136), Expect = 4e-07 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 4/49 (8%) Frame = +1 Query: 175 APWLTK---PKRVSESTTTEHPPH-PQPVKPKNAVERIVFRLRNLGLAS 309 APWLTK PK+V+ES T + P H P +P+NAVERIV RLRNLGL S Sbjct: 49 APWLTKSPSPKKVTESLTADDPIHRTTPKQPQNAVERIVLRLRNLGLPS 97 >KOM54327.1 hypothetical protein LR48_Vigan10g021900 [Vigna angularis] Length = 867 Score = 57.0 bits (136), Expect = 4e-07 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 4/49 (8%) Frame = +1 Query: 175 APWLTK---PKRVSESTTTEHPPH-PQPVKPKNAVERIVFRLRNLGLAS 309 APWLTK PK+V+ES T + P H P +P+NAVERIV RLRNLGL S Sbjct: 49 APWLTKSPSPKKVTESLTADDPIHRTTPKQPQNAVERIVLRLRNLGLPS 97 >XP_014513697.1 PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic-like [Vigna radiata var. radiata] Length = 799 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 4/49 (8%) Frame = +1 Query: 175 APWLTK---PKRVSESTTTEHPPH-PQPVKPKNAVERIVFRLRNLGLAS 309 APWLTK PK+V+E T + P H P +P+NAVERIV RLRNLGL S Sbjct: 48 APWLTKSPSPKKVTEPLTADDPIHRTTPKQPQNAVERIVLRLRNLGLPS 96 >XP_007152752.1 hypothetical protein PHAVU_004G156500g [Phaseolus vulgaris] XP_007152753.1 hypothetical protein PHAVU_004G156500g [Phaseolus vulgaris] ESW24746.1 hypothetical protein PHAVU_004G156500g [Phaseolus vulgaris] ESW24747.1 hypothetical protein PHAVU_004G156500g [Phaseolus vulgaris] Length = 801 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/47 (63%), Positives = 34/47 (72%), Gaps = 4/47 (8%) Frame = +1 Query: 175 APWLTK---PKRVSESTTTEHPPH-PQPVKPKNAVERIVFRLRNLGL 303 APWLTK PKRV+E T + P H P +P+NAVERIV RLRNLGL Sbjct: 48 APWLTKSPSPKRVTEPLTVDDPIHRTTPKQPQNAVERIVLRLRNLGL 94