BLASTX nr result
ID: Glycyrrhiza33_contig00007741
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00007741 (330 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_050226868.1 hypothetical protein [Streptococcus pneumoniae] 141 1e-41 SBT57639.1 hypothetical protein POVWA2_080690 [Plasmodium ovale ... 140 7e-41 WP_050218439.1 hypothetical protein [Streptococcus pneumoniae] 107 3e-28 ELR44476.1 hypothetical protein M91_20944, partial [Bos mutus] 103 1e-26 WP_077128850.1 hypothetical protein [Shigella sonnei] SIH59386.1... 100 6e-26 SIH59232.1 Uncharacterised protein [Mycobacterium abscessus subs... 103 1e-25 CJS63071.1 Uncharacterised protein [Streptococcus pneumoniae] CJ... 103 1e-25 EGV91149.1 hypothetical protein I79_026257 [Cricetulus griseus] 97 1e-24 SJG99250.1 Uncharacterised protein [Shigella sonnei] 100 2e-24 SBT56803.1 hypothetical protein POVWA1_078610 [Plasmodium ovale ... 99 4e-24 WP_057529390.1 hypothetical protein [Streptococcus pneumoniae] 96 4e-24 SIH60289.1 Uncharacterised protein [Mycobacterium abscessus subs... 94 2e-23 SIP65918.1 conserved hypothetical protein [Mycobacterium tubercu... 94 7e-23 SIP65920.1 conserved hypothetical protein [Mycobacterium tubercu... 92 9e-23 WP_077128860.1 hypothetical protein [Shigella sonnei] SIH60322.1... 90 8e-22 CNY23920.1 Uncharacterised protein [Mycobacterium tuberculosis] 89 3e-21 WP_076309326.1 hypothetical protein [Paenibacillus odorifer] OMD... 90 4e-21 WP_077128865.1 hypothetical protein [Shigella sonnei] 88 9e-21 SBT56044.1 hypothetical protein POVWA1_073990 [Plasmodium ovale ... 69 7e-20 SBT57778.1 hypothetical protein POVWA2_081520 [Plasmodium ovale ... 85 1e-19 >WP_050226868.1 hypothetical protein [Streptococcus pneumoniae] Length = 89 Score = 141 bits (355), Expect = 1e-41 Identities = 68/87 (78%), Positives = 75/87 (86%) Frame = -2 Query: 329 AFNSQSLTFLFIEQLGNTLFVKSASGYSDLFEAFVGNGISSFTARQKNSQ*LLCVVCIQL 150 AFNSQSLTFLF+EQ GNTLFVK AS + D EAFVGNGISS+ ARQKNSQ LLCVVCIQ+ Sbjct: 3 AFNSQSLTFLFVEQFGNTLFVKPASAFLDFIEAFVGNGISSYNARQKNSQSLLCVVCIQV 62 Query: 149 TELNDPLHRADLKHSFCGICKWRFQPL 69 TELN PL RA LK+SFCG+CKWRFQ + Sbjct: 63 TELNLPLDRAVLKNSFCGVCKWRFQAI 89 >SBT57639.1 hypothetical protein POVWA2_080690 [Plasmodium ovale wallikeri] Length = 130 Score = 140 bits (353), Expect = 7e-41 Identities = 73/89 (82%), Positives = 75/89 (84%) Frame = +2 Query: 29 FLYEDISFSTIDLKAAEISTCKFHKKSVSNLLCVKDRSTL*VEYTQHKEVTENSSV*Q*M 208 FLYEDISFS KA EISTCKFHK SVSNLL + + STL VEYTQHKEVTENSSV M Sbjct: 42 FLYEDISFSAFGPKALEISTCKFHKNSVSNLLSLNESSTLSVEYTQHKEVTENSSVQHYM 101 Query: 209 KKSRFQRRPQRGLNIHLQTLQTECFLTAL 295 KKSRFQRRPQ GLNIHLQTLQTECFLTAL Sbjct: 102 KKSRFQRRPQGGLNIHLQTLQTECFLTAL 130 >WP_050218439.1 hypothetical protein [Streptococcus pneumoniae] Length = 89 Score = 107 bits (266), Expect = 3e-28 Identities = 57/85 (67%), Positives = 63/85 (74%) Frame = -2 Query: 329 AFNSQSLTFLFIEQLGNTLFVKSASGYSDLFEAFVGNGISSFTARQKNSQ*LLCVVCIQL 150 AF SQS TFL IEQLGNT FV+ A GY D FEAFVGNGISS+ +RQKNSQ L C VCIQL Sbjct: 3 AFKSQSATFLLIEQLGNTPFVEFAMGYLDFFEAFVGNGISSYESRQKNSQKLPCDVCIQL 62 Query: 149 TELNDPLHRADLKHSFCGICKWRFQ 75 +E + PL A LKH FC I K F+ Sbjct: 63 SEWHLPLDTAVLKHCFCSISKRIFR 87 >ELR44476.1 hypothetical protein M91_20944, partial [Bos mutus] Length = 97 Score = 103 bits (257), Expect = 1e-26 Identities = 55/81 (67%), Positives = 60/81 (74%) Frame = -2 Query: 329 AFNSQSLTFLFIEQLGNTLFVKSASGYSDLFEAFVGNGISSFTARQKNSQ*LLCVVCIQL 150 A SQS TFL IEQLGNT FV+ A GY D FEAFVGNGISS+ +RQKNSQ L C VCIQL Sbjct: 14 ACKSQSATFLLIEQLGNTPFVEFAMGYLDFFEAFVGNGISSYESRQKNSQKLPCDVCIQL 73 Query: 149 TELNDPLHRADLKHSFCGICK 87 +E + PL A LKH FC I K Sbjct: 74 SEWHLPLDTAVLKHCFCSISK 94 >WP_077128850.1 hypothetical protein [Shigella sonnei] SIH59386.1 Uncharacterised protein [Mycobacterium abscessus subsp. abscessus] Length = 75 Score = 100 bits (250), Expect = 6e-26 Identities = 55/71 (77%), Positives = 58/71 (81%), Gaps = 1/71 (1%) Frame = -2 Query: 329 AFNSQSLTFLFIEQLGNTLFVKSASGYSDLFEAFVGNGISSFTARQKNSQ*LL-CVVCIQ 153 AFNSQSLTFLFIEQ GN LFVKSASGY ++FEAFVGNGI S+ QKNSQ LL C VCIQ Sbjct: 3 AFNSQSLTFLFIEQFGNPLFVKSASGYLNVFEAFVGNGIFSYKPGQKNSQKLLDCYVCIQ 62 Query: 152 LTELNDPLHRA 120 LTELN L RA Sbjct: 63 LTELNLTLERA 73 >SIH59232.1 Uncharacterised protein [Mycobacterium abscessus subsp. abscessus] Length = 207 Score = 103 bits (258), Expect = 1e-25 Identities = 55/100 (55%), Positives = 65/100 (65%) Frame = +3 Query: 6 FLRMILSSFYTKIFPFLPLTSKRLKSPLANSTKRVFQICSV*RIVQLCELNTHNTXXXXX 185 FLR +LS FY KIFPFLP S+R K PL N+TK VFQ CS+ R CELN+H T Sbjct: 104 FLRWVLSRFYGKIFPFLPYASRRSKYPLGNTTKTVFQNCSIKRKDPHCELNSHITKKSLR 163 Query: 186 XXXXXXXXXNPVSNEGLKEV*ISTCRLYKQSVS*LLYEKK 305 NPVSNEGLK V ISTCR Y+ +VS LLY+++ Sbjct: 164 ILLSGFIGRNPVSNEGLKAVHISTCRFYRNNVSKLLYQEE 203 Score = 81.3 bits (199), Expect = 9e-17 Identities = 49/111 (44%), Positives = 63/111 (56%), Gaps = 14/111 (12%) Frame = +1 Query: 40 RYFLFYH*PQ--------------SG*NLHLQIPQKECFKSALCKGSFNSVS*IHTTQRS 177 RYFLFYH PQ S ++ ++P LC + ++ QRS Sbjct: 3 RYFLFYHRPQGALISAWKYYNHSVSNCSIQRKVP--------LCDLNAHN-------QRS 47 Query: 178 Y*EFFCLAVNEEIPFPTKASKRSEYPLADFTNRVFPNCSMKRKVKLCELNA 330 + EFFCL + EEIPFPTK + S+YPLAD + R F NCS+KR V+LCELNA Sbjct: 48 FGEFFCLDLYEEIPFPTKTQRSSKYPLADPSERGFQNCSIKRNVQLCELNA 98 Score = 47.0 bits (110), Expect(2) = 6e-09 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +1 Query: 217 PFPTKASKRSEYPLADFTNRVFPNCSMKRKVKLCELNA 330 PF AS+RS+YPL + T VF NCS+KRK CELN+ Sbjct: 118 PFLPYASRRSKYPLGNTTKTVFQNCSIKRKDPHCELNS 155 Score = 40.4 bits (93), Expect(2) = 6e-09 Identities = 21/41 (51%), Positives = 26/41 (63%) Frame = +3 Query: 48 PFLPLTSKRLKSPLANSTKRVFQICSV*RIVQLCELNTHNT 170 PF T + K PLA+ ++R FQ CS+ R VQLCELN T Sbjct: 61 PFPTKTQRSSKYPLADPSERGFQNCSIKRNVQLCELNADIT 101 >CJS63071.1 Uncharacterised protein [Streptococcus pneumoniae] CJE28174.1 Uncharacterised protein [Streptococcus pneumoniae] CKC07512.1 Uncharacterised protein [Streptococcus pneumoniae] Length = 207 Score = 103 bits (258), Expect = 1e-25 Identities = 55/100 (55%), Positives = 65/100 (65%) Frame = +3 Query: 6 FLRMILSSFYTKIFPFLPLTSKRLKSPLANSTKRVFQICSV*RIVQLCELNTHNTXXXXX 185 FLR +LS FY KIFPFLP S+R K PL N+TK VFQ CS+ R CELN+H T Sbjct: 104 FLRWVLSRFYGKIFPFLPYASRRSKYPLGNTTKTVFQNCSIKRKDPHCELNSHITKKSLR 163 Query: 186 XXXXXXXXXNPVSNEGLKEV*ISTCRLYKQSVS*LLYEKK 305 NPVSNEGLK V ISTCR Y+ +VS LLY+++ Sbjct: 164 ILLSGFIGRNPVSNEGLKAVHISTCRFYRNNVSKLLYQEE 203 Score = 77.4 bits (189), Expect = 3e-15 Identities = 36/54 (66%), Positives = 43/54 (79%) Frame = +1 Query: 169 QRSY*EFFCLAVNEEIPFPTKASKRSEYPLADFTNRVFPNCSMKRKVKLCELNA 330 QRS+ EFFCL + EEIPFPTK + S+YPLAD + R F NCS+KR V+LCELNA Sbjct: 45 QRSFGEFFCLDLYEEIPFPTKTQRSSKYPLADPSERGFQNCSIKRNVQLCELNA 98 Score = 47.0 bits (110), Expect(2) = 6e-09 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +1 Query: 217 PFPTKASKRSEYPLADFTNRVFPNCSMKRKVKLCELNA 330 PF AS+RS+YPL + T VF NCS+KRK CELN+ Sbjct: 118 PFLPYASRRSKYPLGNTTKTVFQNCSIKRKDPHCELNS 155 Score = 40.4 bits (93), Expect(2) = 6e-09 Identities = 21/41 (51%), Positives = 26/41 (63%) Frame = +3 Query: 48 PFLPLTSKRLKSPLANSTKRVFQICSV*RIVQLCELNTHNT 170 PF T + K PLA+ ++R FQ CS+ R VQLCELN T Sbjct: 61 PFPTKTQRSSKYPLADPSERGFQNCSIKRNVQLCELNADIT 101 >EGV91149.1 hypothetical protein I79_026257 [Cricetulus griseus] Length = 60 Score = 97.1 bits (240), Expect = 1e-24 Identities = 48/50 (96%), Positives = 50/50 (100%) Frame = -2 Query: 329 AFNSQSLTFLFIEQLGNTLFVKSASGYSDLFEAFVGNGISSFTARQKNSQ 180 AFNSQSLTFLFIEQLGNTLFVKSASGYSDLFEAFVGNGISS++ARQKNSQ Sbjct: 11 AFNSQSLTFLFIEQLGNTLFVKSASGYSDLFEAFVGNGISSYSARQKNSQ 60 >SJG99250.1 Uncharacterised protein [Shigella sonnei] Length = 207 Score = 100 bits (250), Expect = 2e-24 Identities = 54/100 (54%), Positives = 65/100 (65%) Frame = +3 Query: 6 FLRMILSSFYTKIFPFLPLTSKRLKSPLANSTKRVFQICSV*RIVQLCELNTHNTXXXXX 185 FLR++LS FY KIFPFLP S+R K PL N+TK FQ CS+ R CELN+H T Sbjct: 104 FLRLVLSRFYGKIFPFLPYASRRSKYPLGNTTKTGFQNCSIKRKDPHCELNSHITKKSLR 163 Query: 186 XXXXXXXXXNPVSNEGLKEV*ISTCRLYKQSVS*LLYEKK 305 NPVSNEGLKEV ISTCR Y+ +VS LL +++ Sbjct: 164 ILLSGFIGRNPVSNEGLKEVQISTCRFYRNNVSKLLGQEE 203 Score = 80.1 bits (196), Expect = 3e-16 Identities = 48/111 (43%), Positives = 63/111 (56%), Gaps = 14/111 (12%) Frame = +1 Query: 40 RYFLFYH*PQ--------------SG*NLHLQIPQKECFKSALCKGSFNSVS*IHTTQRS 177 RYFLFYH PQ S ++ ++P LC + ++ QRS Sbjct: 3 RYFLFYHRPQGALISAWKYYNHGVSNCSIQRKVP--------LCDLNAHN-------QRS 47 Query: 178 Y*EFFCLAVNEEIPFPTKASKRSEYPLADFTNRVFPNCSMKRKVKLCELNA 330 + EFFCL + EEIPFPTK + S+YPLAD + R F NCS+KR V+LC+LNA Sbjct: 48 FGEFFCLDLYEEIPFPTKTQRSSKYPLADPSERGFQNCSIKRNVQLCDLNA 98 Score = 44.3 bits (103), Expect(2) = 9e-08 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +1 Query: 217 PFPTKASKRSEYPLADFTNRVFPNCSMKRKVKLCELNA 330 PF AS+RS+YPL + T F NCS+KRK CELN+ Sbjct: 118 PFLPYASRRSKYPLGNTTKTGFQNCSIKRKDPHCELNS 155 Score = 39.3 bits (90), Expect(2) = 9e-08 Identities = 20/41 (48%), Positives = 26/41 (63%) Frame = +3 Query: 48 PFLPLTSKRLKSPLANSTKRVFQICSV*RIVQLCELNTHNT 170 PF T + K PLA+ ++R FQ CS+ R VQLC+LN T Sbjct: 61 PFPTKTQRSSKYPLADPSERGFQNCSIKRNVQLCDLNADIT 101 >SBT56803.1 hypothetical protein POVWA1_078610 [Plasmodium ovale wallikeri] Length = 158 Score = 99.0 bits (245), Expect = 4e-24 Identities = 58/104 (55%), Positives = 67/104 (64%) Frame = +3 Query: 15 MILSSFYTKIFPFLPLTSKRLKSPLANSTKRVFQICSV*RIVQLCELNTHNTXXXXXXXX 194 M+LS FY KIFPF +SK K PL +STKRVFQ CS+ R V L +L TH T Sbjct: 1 MLLSRFYMKIFPFPTKSSKLSKYPLGDSTKRVFQNCSIKRKVLLRQLRTHITKVSENASV 60 Query: 195 XXXXXXNPVSNEGLKEV*ISTCRLYKQSVS*LLYEKKG*TL*VE 326 NPVSNE LK++ I +CR YK+SVS LLYEKKG TL VE Sbjct: 61 WILSEDNPVSNEILKDMQICSCRFYKKSVSKLLYEKKGSTLLVE 104 Score = 60.5 bits (145), Expect = 3e-09 Identities = 36/64 (56%), Positives = 42/64 (65%) Frame = +2 Query: 5 VSENDSV*FLYEDISFSTIDLKAAEISTCKFHKKSVSNLLCVKDRSTL*VEYTQHKEVTE 184 VSEN SV L ED S LK +I +C+F+KKSVS LL K STL VE T HK+V E Sbjct: 54 VSENASVWILSEDNPVSNEILKDMQICSCRFYKKSVSKLLYEKKGSTLLVEGTHHKQVAE 113 Query: 185 NSSV 196 N+SV Sbjct: 114 NASV 117 Score = 53.9 bits (128), Expect = 1e-06 Identities = 26/48 (54%), Positives = 35/48 (72%) Frame = +2 Query: 5 VSENDSV*FLYEDISFSTIDLKAAEISTCKFHKKSVSNLLCVKDRSTL 148 V+EN SV FL+EDISFS L A ++ T ++ K+SVSNL C ++RS L Sbjct: 111 VAENASVWFLWEDISFSNTSLNALQMDTSRYDKRSVSNLFCERERSIL 158 >WP_057529390.1 hypothetical protein [Streptococcus pneumoniae] Length = 60 Score = 95.9 bits (237), Expect = 4e-24 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = -2 Query: 329 AFNSQSLTFLFIEQLGNTLFVKSASGYSDLFEAFVGNGISSFTARQKNSQ 180 AFNSQSLTFLFIEQLGNTLFVKSASGYSDLFEAFVGNGISS+ ARQKNSQ Sbjct: 11 AFNSQSLTFLFIEQLGNTLFVKSASGYSDLFEAFVGNGISSYYARQKNSQ 60 >SIH60289.1 Uncharacterised protein [Mycobacterium abscessus subsp. abscessus] Length = 60 Score = 94.0 bits (232), Expect = 2e-23 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = -2 Query: 329 AFNSQSLTFLFIEQLGNTLFVKSASGYSDLFEAFVGNGISSFTARQKNSQ 180 AFNSQSLTFLFIEQLGNTLFV SASGYSDLFEAFVGNGISS+ ARQKNSQ Sbjct: 11 AFNSQSLTFLFIEQLGNTLFVNSASGYSDLFEAFVGNGISSYYARQKNSQ 60 Score = 51.2 bits (121), Expect = 2e-06 Identities = 26/41 (63%), Positives = 29/41 (70%) Frame = -3 Query: 187 ILSNFFVLCVFNSQS*TILYTEQI*NTLFVEFASGDFSRFE 65 IL NFFV+C FNSQS T L+ EQ+ NTLFV ASG FE Sbjct: 2 ILRNFFVMCAFNSQSLTFLFIEQLGNTLFVNSASGYSDLFE 42 >SIP65918.1 conserved hypothetical protein [Mycobacterium tuberculosis] Length = 87 Score = 93.6 bits (231), Expect = 7e-23 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = -2 Query: 329 AFNSQSLTFLFIEQLGNTLFVKSASGYSDLFEAFVGNGISSFTARQKNSQ 180 +FNSQSLTFLFIEQLGNTLFVKSASGYSDL EAFVGNGISS++ARQKNSQ Sbjct: 38 SFNSQSLTFLFIEQLGNTLFVKSASGYSDLLEAFVGNGISSYSARQKNSQ 87 Score = 52.8 bits (125), Expect = 7e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 100 VEFASGDFSRFEVNGRKGNIFV*KLDRIILRNC 2 ++FAS DF RF+VNGRKGNIFV KLDRII NC Sbjct: 1 MQFASVDFKRFKVNGRKGNIFVSKLDRIIPTNC 33 >SIP65920.1 conserved hypothetical protein [Mycobacterium tuberculosis] Length = 60 Score = 92.4 bits (228), Expect = 9e-23 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = -2 Query: 329 AFNSQSLTFLFIEQLGNTLFVKSASGYSDLFEAFVGNGISSFTARQKNSQ 180 AFNSQSLTFLFIEQ GNTLFVKSASGY DLFEAFVGNGISSF AR+KNSQ Sbjct: 11 AFNSQSLTFLFIEQFGNTLFVKSASGYLDLFEAFVGNGISSFNARRKNSQ 60 >WP_077128860.1 hypothetical protein [Shigella sonnei] SIH60322.1 Uncharacterised protein [Mycobacterium abscessus subsp. abscessus] Length = 60 Score = 90.1 bits (222), Expect = 8e-22 Identities = 45/50 (90%), Positives = 46/50 (92%) Frame = -2 Query: 329 AFNSQSLTFLFIEQLGNTLFVKSASGYSDLFEAFVGNGISSFTARQKNSQ 180 AFNSQSLTFLFIEQLGNTLFVKSASGYSDL EAFVGNG S+ ARQKNSQ Sbjct: 11 AFNSQSLTFLFIEQLGNTLFVKSASGYSDLLEAFVGNGFFSYKARQKNSQ 60 >CNY23920.1 Uncharacterised protein [Mycobacterium tuberculosis] Length = 60 Score = 88.6 bits (218), Expect = 3e-21 Identities = 45/50 (90%), Positives = 46/50 (92%) Frame = -2 Query: 329 AFNSQSLTFLFIEQLGNTLFVKSASGYSDLFEAFVGNGISSFTARQKNSQ 180 AFNSQSLTFLF EQLGNTLFVK ASGYSDLFEAFVGNGISS+ ARQK SQ Sbjct: 11 AFNSQSLTFLFTEQLGNTLFVKPASGYSDLFEAFVGNGISSYYARQKISQ 60 Score = 50.1 bits (118), Expect = 4e-06 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = -3 Query: 187 ILSNFFVLCVFNSQS*TILYTEQI*NTLFVEFASGDFSRFE 65 IL N FV+C FNSQS T L+TEQ+ NTLFV+ ASG FE Sbjct: 2 ILRNSFVMCAFNSQSLTFLFTEQLGNTLFVKPASGYSDLFE 42 >WP_076309326.1 hypothetical protein [Paenibacillus odorifer] OMD83165.1 hypothetical protein BSK67_30225 [Paenibacillus odorifer] Length = 119 Score = 90.1 bits (222), Expect = 4e-21 Identities = 45/66 (68%), Positives = 50/66 (75%) Frame = -2 Query: 200 ARQKNSQ*LLCVVCIQLTELNDPLHRADLKHSFCGICKWRFQPL*GQW*KRKYLRIKTRQ 21 +RQ++SQ +LC VCIQ+TELN P HRA LKHSFC I KW F L G KRKYL IKTRQ Sbjct: 21 SRQQHSQKVLCDVCIQVTELNSPFHRAGLKHSFCSIWKWTFGALSGLRWKRKYLPIKTRQ 80 Query: 20 NHSQKL 3 HSQKL Sbjct: 81 KHSQKL 86 Score = 59.7 bits (143), Expect(2) = 5e-17 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -2 Query: 197 RQKNSQ*LLCVVCIQLTELNDPLHRADLKHSFCGICKWRF 78 RQK+SQ L+C VC QLT+LN RA LKHSFCGICKW F Sbjct: 79 RQKHSQKLVCDVCPQLTQLNLSFERAVLKHSFCGICKWIF 118 Score = 55.1 bits (131), Expect(2) = 5e-17 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = -1 Query: 330 CVQLTEFNLSFHRAVRKHSVCKVCKWIFRPL*GLRWKRDF 211 C+Q+TE N FHRA KHS C + KW F L GLRWKR + Sbjct: 34 CIQVTELNSPFHRAGLKHSFCSIWKWTFGALSGLRWKRKY 73 >WP_077128865.1 hypothetical protein [Shigella sonnei] Length = 87 Score = 88.2 bits (217), Expect = 9e-21 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = -2 Query: 326 FNSQSLTFLFIEQLGNTLFVKSASGYSDLFEAFVGNGISSFTARQKNSQ 180 FNSQSLTFLFIEQL NTLF+KSASGYSDL EAFVGNGISS+ ARQKNSQ Sbjct: 39 FNSQSLTFLFIEQLVNTLFIKSASGYSDLLEAFVGNGISSYYARQKNSQ 87 Score = 58.5 bits (140), Expect = 4e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 100 VEFASGDFSRFEVNGRKGNIFV*KLDRIILRN 5 +EFASGDFSRFEVN RKGNIFV KLDR+ILRN Sbjct: 1 MEFASGDFSRFEVNSRKGNIFVEKLDRMILRN 32 Score = 53.5 bits (127), Expect = 4e-07 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -3 Query: 199 LDRRILSNFFVLCVFNSQS*TILYTEQI*NTLFVEFASG 83 LDR IL N FV+CVFNSQS T L+ EQ+ NTLF++ ASG Sbjct: 25 LDRMILRNSFVMCVFNSQSLTFLFIEQLVNTLFIKSASG 63 >SBT56044.1 hypothetical protein POVWA1_073990 [Plasmodium ovale wallikeri] Length = 333 Score = 68.9 bits (167), Expect(2) = 7e-20 Identities = 37/55 (67%), Positives = 40/55 (72%) Frame = +3 Query: 6 FLRMILSSFYTKIFPFLPLTSKRLKSPLANSTKRVFQICSV*RIVQLCELNTHNT 170 FLRM+LSSFY KIFPF P SK K PLA+S KRVF CS R VQL ELNT+ T Sbjct: 129 FLRMLLSSFYVKIFPFPPQASKPSKRPLADSRKRVFHSCSFKRKVQLWELNTNIT 183 Score = 55.5 bits (132), Expect(2) = 7e-20 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +1 Query: 214 IPFPTKASKRSEYPLADFTNRVFPNCSMKRKVKLCELNA 330 IPFPTK+S+RS+YPLAD T RVF NCS+ V+L ELN+ Sbjct: 224 IPFPTKSSERSKYPLADSTKRVFGNCSIITNVQLPELNS 262 Score = 49.3 bits (116), Expect(2) = 2e-11 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = +1 Query: 217 PFPTKASKRSEYPLADFTNRVFPNCSMKRKVKLCELN 327 PFP +ASK S+ PLAD RVF +CS KRKV+L ELN Sbjct: 143 PFPPQASKPSKRPLADSRKRVFHSCSFKRKVQLWELN 179 Score = 46.6 bits (109), Expect(2) = 2e-11 Identities = 31/66 (46%), Positives = 37/66 (56%), Gaps = 15/66 (22%) Frame = +3 Query: 6 FLRMILSSFYTKIFPF---------------LPLTSKRLKSPLANSTKRVFQICSV*RIV 140 FLR+ + S Y K+FPF SK+ KSP A+STKRV ICS+ RIV Sbjct: 58 FLRVFVFS-YGKLFPFPTKSSESSKYPPADSTKSASKQSKSPFADSTKRVIPICSINRIV 116 Query: 141 QLCELN 158 QL ELN Sbjct: 117 QLHELN 122 Score = 49.7 bits (117), Expect(2) = 3e-11 Identities = 26/39 (66%), Positives = 31/39 (79%), Gaps = 2/39 (5%) Frame = +1 Query: 220 FPT--KASKRSEYPLADFTNRVFPNCSMKRKVKLCELNA 330 FP+ +ASKRS+ PLAD T RVF NCS+KR V+L ELNA Sbjct: 281 FPSLPQASKRSKSPLADSTKRVFANCSIKRNVQLWELNA 319 Score = 45.4 bits (106), Expect(2) = 3e-11 Identities = 25/48 (52%), Positives = 32/48 (66%) Frame = +3 Query: 18 ILSSFYTKIFPFLPLTSKRLKSPLANSTKRVFQICSV*RIVQLCELNT 161 +L Y K+ PF +S+R K PLA+STKRVF CS+ VQL ELN+ Sbjct: 215 LLPFSYGKLIPFPTKSSERSKYPLADSTKRVFGNCSIITNVQLPELNS 262 Score = 65.5 bits (158), Expect = 3e-10 Identities = 34/51 (66%), Positives = 38/51 (74%) Frame = +3 Query: 6 FLRMILSSFYTKIFPFLPLTSKRLKSPLANSTKRVFQICSV*RIVQLCELN 158 FLR++ S FY K FP LP SKR KSPLA+STKRVF CS+ R VQL ELN Sbjct: 268 FLRVLPSGFYMKFFPSLPQASKRSKSPLADSTKRVFANCSIKRNVQLWELN 318 >SBT57778.1 hypothetical protein POVWA2_081520 [Plasmodium ovale wallikeri] Length = 67 Score = 84.7 bits (208), Expect = 1e-19 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +1 Query: 208 EEIPFPTKASKRSEYPLADFTNRVFPNCSMKRKVKLCELNA 330 EEIPFPTKASKRS+YPLADFTNRVFPNCSMKRKVKLCEL A Sbjct: 23 EEIPFPTKASKRSKYPLADFTNRVFPNCSMKRKVKLCELKA 63