BLASTX nr result
ID: Glycyrrhiza33_contig00007485
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00007485 (433 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015939016.1 PREDICTED: RPM1-interacting protein 4-like [Arach... 74 3e-13 XP_016176548.1 PREDICTED: RPM1-interacting protein 4-like [Arach... 72 2e-12 XP_015939015.1 PREDICTED: RPM1-interacting protein 4-like isofor... 72 2e-12 XP_004510259.1 PREDICTED: RPM1-interacting protein 4 isoform X2 ... 72 2e-12 XP_004510258.1 PREDICTED: RPM1-interacting protein 4 isoform X1 ... 72 2e-12 XP_015939014.1 PREDICTED: RPM1-interacting protein 4-like isofor... 72 2e-12 XP_016176631.1 PREDICTED: RPM1-interacting protein 4-like [Arach... 72 2e-12 XP_013444158.1 RPM1 interacting protein 4 transcript protein [Me... 70 7e-12 ACJ84192.1 unknown [Medicago truncatula] 70 7e-12 AFK38280.1 unknown [Medicago truncatula] 69 3e-11 AFK45254.1 unknown [Lotus japonicus] 68 6e-11 XP_019413019.1 PREDICTED: RPM1-interacting protein 4-like isofor... 66 2e-10 XP_019413018.1 PREDICTED: RPM1-interacting protein 4-like isofor... 66 3e-10 XP_007140655.1 hypothetical protein PHAVU_008G130600g [Phaseolus... 64 8e-10 NP_001235221.1 RIN4a protein [Glycine max] ADJ67468.1 RIN4a prot... 65 9e-10 ACU19101.1 unknown [Glycine max] 65 9e-10 XP_007140654.1 hypothetical protein PHAVU_008G130600g [Phaseolus... 64 1e-09 KHN41383.1 RPM1-interacting protein 4 [Glycine soja] 64 2e-09 XP_019461356.1 PREDICTED: RPM1-interacting protein 4-like isofor... 63 2e-09 XP_019461355.1 PREDICTED: RPM1-interacting protein 4-like isofor... 63 2e-09 >XP_015939016.1 PREDICTED: RPM1-interacting protein 4-like [Arachis duranensis] Length = 245 Score = 73.9 bits (180), Expect = 3e-13 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = +3 Query: 3 VREERQGGAGNAPGTPNERPYVMRSQPTDDKAKCCCFWLGKK 128 VREERQGGAG PGTPN+RP+++R+QP++DKA+CCCFW K Sbjct: 204 VREERQGGAGVTPGTPNQRPHLIRNQPSNDKAQCCCFWWSNK 245 >XP_016176548.1 PREDICTED: RPM1-interacting protein 4-like [Arachis ipaensis] Length = 245 Score = 72.0 bits (175), Expect = 2e-12 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = +3 Query: 3 VREERQGGAGNAPGTPNERPYVMRSQPTDDKAKCCCFWLGKK 128 VREERQGGAG PGTPN+RP+++R+QP++DK +CCCFW K Sbjct: 204 VREERQGGAGVTPGTPNQRPHLIRNQPSNDKPQCCCFWWSNK 245 >XP_015939015.1 PREDICTED: RPM1-interacting protein 4-like isoform X2 [Arachis duranensis] Length = 245 Score = 72.0 bits (175), Expect = 2e-12 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = +3 Query: 3 VREERQGGAGNAPGTPNERPYVMRSQPTDDKAKCCCFWLGKK 128 VREERQGGAG PGTPN+RP+ +++QP++DKA+CCCFW K Sbjct: 204 VREERQGGAGVTPGTPNQRPHFIKNQPSNDKAQCCCFWWSNK 245 >XP_004510259.1 PREDICTED: RPM1-interacting protein 4 isoform X2 [Cicer arietinum] Length = 259 Score = 72.0 bits (175), Expect = 2e-12 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +3 Query: 3 VREERQGGAGNAPGTPNERPYVMRSQPTDDKAKCCCFWLGKK 128 VREE+QGGAG APGTPNERP+V+R QP + KA+CCCF GKK Sbjct: 218 VREEKQGGAGYAPGTPNERPHVIRRQPANGKAQCCCFAWGKK 259 >XP_004510258.1 PREDICTED: RPM1-interacting protein 4 isoform X1 [Cicer arietinum] Length = 260 Score = 72.0 bits (175), Expect = 2e-12 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +3 Query: 3 VREERQGGAGNAPGTPNERPYVMRSQPTDDKAKCCCFWLGKK 128 VREE+QGGAG APGTPNERP+V+R QP + KA+CCCF GKK Sbjct: 219 VREEKQGGAGYAPGTPNERPHVIRRQPANGKAQCCCFAWGKK 260 >XP_015939014.1 PREDICTED: RPM1-interacting protein 4-like isoform X1 [Arachis duranensis] Length = 275 Score = 72.0 bits (175), Expect = 2e-12 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = +3 Query: 3 VREERQGGAGNAPGTPNERPYVMRSQPTDDKAKCCCFWLGKK 128 VREERQGGAG PGTPN+RP+ +++QP++DKA+CCCFW K Sbjct: 234 VREERQGGAGVTPGTPNQRPHFIKNQPSNDKAQCCCFWWSNK 275 >XP_016176631.1 PREDICTED: RPM1-interacting protein 4-like [Arachis ipaensis] Length = 277 Score = 72.0 bits (175), Expect = 2e-12 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = +3 Query: 3 VREERQGGAGNAPGTPNERPYVMRSQPTDDKAKCCCFWLGKK 128 VREERQGGAG PGTPN+RP+ +++QP++DKA+CCCFW K Sbjct: 236 VREERQGGAGVTPGTPNQRPHFIKNQPSNDKAQCCCFWWSNK 277 >XP_013444158.1 RPM1 interacting protein 4 transcript protein [Medicago truncatula] KEH18185.1 RPM1 interacting protein 4 transcript protein [Medicago truncatula] Length = 260 Score = 70.5 bits (171), Expect = 7e-12 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +3 Query: 3 VREERQGGAGNAPGTPNERPYVMRSQPTDDKAKCCCFWLGKK 128 VREERQGGAG+APGTPNERP+V+R+Q +DKA+CCCF GKK Sbjct: 220 VREERQGGAGHAPGTPNERPHVIRNQ-NNDKAQCCCFAWGKK 260 >ACJ84192.1 unknown [Medicago truncatula] Length = 260 Score = 70.5 bits (171), Expect = 7e-12 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +3 Query: 3 VREERQGGAGNAPGTPNERPYVMRSQPTDDKAKCCCFWLGKK 128 VREERQGGAG+APGTPNERP+V+R+Q +DKA+CCCF GKK Sbjct: 220 VREERQGGAGHAPGTPNERPHVIRNQ-NNDKAQCCCFAWGKK 260 >AFK38280.1 unknown [Medicago truncatula] Length = 260 Score = 68.9 bits (167), Expect = 3e-11 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +3 Query: 3 VREERQGGAGNAPGTPNERPYVMRSQPTDDKAKCCCFWLGKK 128 VREERQGGAG+APGTPNERP+V+R+Q +DKA+CCCF GK+ Sbjct: 220 VREERQGGAGHAPGTPNERPHVIRNQ-NNDKAQCCCFAWGKE 260 >AFK45254.1 unknown [Lotus japonicus] Length = 250 Score = 67.8 bits (164), Expect = 6e-11 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +3 Query: 3 VREERQGGAGNAPGTPNERPYVMRSQPTDDKAKCCCFWLGKK 128 VREERQGGAGNA GTP ERP+V+RSQP++DK +CCCF KK Sbjct: 210 VREERQGGAGNALGTP-ERPHVIRSQPSNDKVQCCCFGFSKK 250 >XP_019413019.1 PREDICTED: RPM1-interacting protein 4-like isoform X2 [Lupinus angustifolius] Length = 242 Score = 66.2 bits (160), Expect = 2e-10 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = +3 Query: 3 VREERQGGAGNAPGTPNERPYVMRSQPTDDKAKCCCFWLGKK 128 VREERQ AGNAPGTPN R Y +++QP D+K + CCFW G+K Sbjct: 201 VREERQVAAGNAPGTPNGRSYAVKNQPADNKGQSCCFWWGRK 242 >XP_019413018.1 PREDICTED: RPM1-interacting protein 4-like isoform X1 [Lupinus angustifolius] Length = 260 Score = 66.2 bits (160), Expect = 3e-10 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = +3 Query: 3 VREERQGGAGNAPGTPNERPYVMRSQPTDDKAKCCCFWLGKK 128 VREERQ AGNAPGTPN R Y +++QP D+K + CCFW G+K Sbjct: 219 VREERQVAAGNAPGTPNGRSYAVKNQPADNKGQSCCFWWGRK 260 >XP_007140655.1 hypothetical protein PHAVU_008G130600g [Phaseolus vulgaris] ESW12649.1 hypothetical protein PHAVU_008G130600g [Phaseolus vulgaris] Length = 217 Score = 64.3 bits (155), Expect = 8e-10 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +3 Query: 3 VREERQGGAGNAPGTPNERPYVMRSQPTDDKAKCCCFWLGKK 128 VREE+Q GAG+ PGTPN R Y R+ P D+KA+ CCFW GKK Sbjct: 176 VREEKQVGAGHVPGTPNARQYGARNHPDDEKAQSCCFWWGKK 217 >NP_001235221.1 RIN4a protein [Glycine max] ADJ67468.1 RIN4a protein [Glycine max] KHN36440.1 RPM1-interacting protein 4 [Glycine soja] KRH66117.1 hypothetical protein GLYMA_03G084000 [Glycine max] Length = 246 Score = 64.7 bits (156), Expect = 9e-10 Identities = 29/43 (67%), Positives = 31/43 (72%), Gaps = 1/43 (2%) Frame = +3 Query: 3 VREERQGGAGNAPGTPNERPYVMRSQPTDDKAKCCCF-WLGKK 128 VREERQG G PGTPNERP +R Q DDK +CCCF W GKK Sbjct: 204 VREERQGVPGQVPGTPNERPQAIRGQSNDDKVQCCCFAWGGKK 246 >ACU19101.1 unknown [Glycine max] Length = 246 Score = 64.7 bits (156), Expect = 9e-10 Identities = 29/43 (67%), Positives = 31/43 (72%), Gaps = 1/43 (2%) Frame = +3 Query: 3 VREERQGGAGNAPGTPNERPYVMRSQPTDDKAKCCCF-WLGKK 128 VREERQG G PGTPNERP +R Q DDK +CCCF W GKK Sbjct: 204 VREERQGVPGQVPGTPNERPQAIRGQSNDDKVQCCCFAWGGKK 246 >XP_007140654.1 hypothetical protein PHAVU_008G130600g [Phaseolus vulgaris] ESW12648.1 hypothetical protein PHAVU_008G130600g [Phaseolus vulgaris] Length = 253 Score = 64.3 bits (155), Expect = 1e-09 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +3 Query: 3 VREERQGGAGNAPGTPNERPYVMRSQPTDDKAKCCCFWLGKK 128 VREE+Q GAG+ PGTPN R Y R+ P D+KA+ CCFW GKK Sbjct: 212 VREEKQVGAGHVPGTPNARQYGARNHPDDEKAQSCCFWWGKK 253 >KHN41383.1 RPM1-interacting protein 4 [Glycine soja] Length = 238 Score = 63.9 bits (154), Expect = 2e-09 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +3 Query: 3 VREERQGGAGNAPGTPNERPYVMRSQPTDDKAKCCCFWLGKK 128 VREE+Q GAG+ PGTPN R Y R+QP DDKA+ CCF GKK Sbjct: 197 VREEKQVGAGHVPGTPNGRQYAARNQPADDKAQSCCFCWGKK 238 >XP_019461356.1 PREDICTED: RPM1-interacting protein 4-like isoform X2 [Lupinus angustifolius] Length = 223 Score = 63.2 bits (152), Expect = 2e-09 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +3 Query: 3 VREERQGGAGNAPGTPNERPYVMRSQPTDDKAKCCCFWLGKK 128 VREERQ AGNAPGTPN R Y +++Q +DK + CCFW G+K Sbjct: 182 VREERQVAAGNAPGTPNGRSYAVKNQAANDKGQSCCFWWGRK 223 >XP_019461355.1 PREDICTED: RPM1-interacting protein 4-like isoform X1 [Lupinus angustifolius] Length = 224 Score = 63.2 bits (152), Expect = 2e-09 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +3 Query: 3 VREERQGGAGNAPGTPNERPYVMRSQPTDDKAKCCCFWLGKK 128 VREERQ AGNAPGTPN R Y +++Q +DK + CCFW G+K Sbjct: 183 VREERQVAAGNAPGTPNGRSYAVKNQAANDKGQSCCFWWGRK 224