BLASTX nr result
ID: Glycyrrhiza33_contig00007189
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00007189 (375 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU42368.1 hypothetical protein TSUD_350340 [Trifolium subterran... 75 3e-13 KYP55999.1 Putative F-box/LRR-repeat protein At5g41840 family [C... 73 4e-13 GAU30179.1 hypothetical protein TSUD_311300 [Trifolium subterran... 73 4e-13 KHN10564.1 F-box/FBD/LRR-repeat protein, partial [Glycine soja] 74 5e-13 GAU13047.1 hypothetical protein TSUD_173470 [Trifolium subterran... 74 5e-13 XP_012575618.1 PREDICTED: F-box/FBD/LRR-repeat protein At4g26340... 74 7e-13 XP_003599614.1 F-box/RNI superfamily protein [Medicago truncatul... 68 1e-12 XP_013461191.1 cyclin-like F-box protein [Medicago truncatula] K... 73 1e-12 XP_003601547.1 cyclin-like F-box protein [Medicago truncatula] A... 73 2e-12 GAU38249.1 hypothetical protein TSUD_119290 [Trifolium subterran... 72 2e-12 XP_003591969.2 F-box-like protein [Medicago truncatula] AES62220... 69 2e-12 XP_003622277.1 cyclin-like F-box protein [Medicago truncatula] A... 72 2e-12 KRG99696.1 hypothetical protein GLYMA_18G164400 [Glycine max] 72 2e-12 ABN05919.1 Cyclin-like F-box; FBD [Medicago truncatula] 71 3e-12 XP_003624289.1 F-box/RNI/FBD-like domain protein [Medicago trunc... 71 3e-12 XP_014626130.1 PREDICTED: FBD-associated F-box protein At4g10400... 72 3e-12 XP_013450532.1 F-box/RNI/FBD-like domain protein [Medicago trunc... 72 4e-12 XP_003599617.1 cyclin-like F-box protein [Medicago truncatula] A... 71 4e-12 GAU13045.1 hypothetical protein TSUD_173450 [Trifolium subterran... 71 6e-12 GAU30177.1 hypothetical protein TSUD_311280 [Trifolium subterran... 71 6e-12 >GAU42368.1 hypothetical protein TSUD_350340 [Trifolium subterraneum] Length = 389 Score = 74.7 bits (182), Expect = 3e-13 Identities = 33/40 (82%), Positives = 39/40 (97%) Frame = -2 Query: 122 DRISTLPDSILCHILSYLPTKLAVATSILSRRWRPLWLSV 3 DR+S+LPDSILCHILS+LPTK AVAT+ILS+RW+PLWLSV Sbjct: 49 DRVSSLPDSILCHILSFLPTKEAVATTILSKRWKPLWLSV 88 >KYP55999.1 Putative F-box/LRR-repeat protein At5g41840 family [Cajanus cajan] Length = 234 Score = 72.8 bits (177), Expect = 4e-13 Identities = 31/42 (73%), Positives = 39/42 (92%) Frame = -2 Query: 128 MADRISTLPDSILCHILSYLPTKLAVATSILSRRWRPLWLSV 3 MADRIS+LPD ++CHILS+LPTK AVATS+L++ W+PLWLSV Sbjct: 1 MADRISSLPDELVCHILSFLPTKEAVATSVLAKNWKPLWLSV 42 >GAU30179.1 hypothetical protein TSUD_311300 [Trifolium subterraneum] Length = 238 Score = 72.8 bits (177), Expect = 4e-13 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -2 Query: 137 LPTMADRISTLPDSILCHILSYLPTKLAVATSILSRRWRPLWLS 6 +PT DRIS LPDSILCHILS+LPTKL+ TSILS+RW+PLWLS Sbjct: 12 IPT-EDRISILPDSILCHILSFLPTKLSATTSILSKRWKPLWLS 54 >KHN10564.1 F-box/FBD/LRR-repeat protein, partial [Glycine soja] Length = 385 Score = 73.9 bits (180), Expect = 5e-13 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -2 Query: 131 TMADRISTLPDSILCHILSYLPTKLAVATSILSRRWRPLWLSV 3 TMADRIS+LPD++LCHILS+LPT +VATS+LS+RWRPLW SV Sbjct: 13 TMADRISSLPDTLLCHILSFLPTIESVATSVLSKRWRPLWRSV 55 >GAU13047.1 hypothetical protein TSUD_173470 [Trifolium subterraneum] Length = 387 Score = 73.9 bits (180), Expect = 5e-13 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -2 Query: 134 PTMADRISTLPDSILCHILSYLPTKLAVATSILSRRWRPLWLSV 3 PT+ DRISTLPDSI+CHILS+ PTK A ATSILS+RW PLWLSV Sbjct: 4 PTV-DRISTLPDSIICHILSFFPTKQAAATSILSKRWNPLWLSV 46 >XP_012575618.1 PREDICTED: F-box/FBD/LRR-repeat protein At4g26340-like [Cicer arietinum] XP_012575619.1 PREDICTED: F-box/FBD/LRR-repeat protein At4g26340-like [Cicer arietinum] Length = 379 Score = 73.6 bits (179), Expect = 7e-13 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -2 Query: 128 MADRISTLPDSILCHILSYLPTKLAVATSILSRRWRPLWLSV 3 MAD IS LPDSILCHILS+LPTK A TSILS+RW+PLWLSV Sbjct: 1 MADTISDLPDSILCHILSFLPTKHAATTSILSKRWKPLWLSV 42 >XP_003599614.1 F-box/RNI superfamily protein [Medicago truncatula] AES69865.1 F-box/RNI superfamily protein [Medicago truncatula] Length = 80 Score = 67.8 bits (164), Expect = 1e-12 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -2 Query: 131 TMADRISTLPDSILCHILSYLPTKLAVATSILSRRWRPLWLSV 3 +MADRI TL DSILCHI+S+LPTK A ATSILS+RW+ LWL V Sbjct: 4 SMADRIITLHDSILCHIVSFLPTKHAAATSILSKRWKSLWLLV 46 Score = 52.8 bits (125), Expect = 1e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 137 LPTMADRISTLPDSILCHILSYLPTKLAVATSIL 36 L + DRISTLP+S+LCHILS+LPTK A ATSIL Sbjct: 47 LTLLEDRISTLPNSVLCHILSFLPTKHAAATSIL 80 >XP_013461191.1 cyclin-like F-box protein [Medicago truncatula] KEH35225.1 cyclin-like F-box protein [Medicago truncatula] Length = 441 Score = 72.8 bits (177), Expect = 1e-12 Identities = 34/46 (73%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = -2 Query: 137 LPT-MADRISTLPDSILCHILSYLPTKLAVATSILSRRWRPLWLSV 3 +PT DR+S+LPDSI+CHILS+LPTK VATSILS+RW PLWLSV Sbjct: 11 IPTEKCDRVSSLPDSIICHILSFLPTKDTVATSILSKRWNPLWLSV 56 >XP_003601547.1 cyclin-like F-box protein [Medicago truncatula] AES71798.1 cyclin-like F-box protein [Medicago truncatula] Length = 484 Score = 72.8 bits (177), Expect = 2e-12 Identities = 34/46 (73%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = -2 Query: 137 LPT-MADRISTLPDSILCHILSYLPTKLAVATSILSRRWRPLWLSV 3 +PT DR+S+LPDSI+CHILS+LPTK VATSILS+RW PLWLSV Sbjct: 91 IPTEKCDRVSSLPDSIICHILSFLPTKDTVATSILSKRWNPLWLSV 136 >GAU38249.1 hypothetical protein TSUD_119290 [Trifolium subterraneum] Length = 505 Score = 72.4 bits (176), Expect = 2e-12 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = -2 Query: 137 LPTMADRISTLPDSILCHILSYLPTKLAVATSILSRRWRPLWLSV 3 +PT DRIS LPD ILCHILS+LPTK A TSILS+RW+PLWLSV Sbjct: 8 IPT-TDRISELPDPILCHILSFLPTKFAATTSILSKRWKPLWLSV 51 >XP_003591969.2 F-box-like protein [Medicago truncatula] AES62220.2 F-box-like protein [Medicago truncatula] Length = 143 Score = 68.9 bits (167), Expect = 2e-12 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -2 Query: 137 LPTMADRISTLPDSILCHILSYLPTKLAVATSILSRRWRPLWLSV 3 +PT+ DRIS LPDSILCHILS++PTKLA TS+LS+RW +WLSV Sbjct: 42 IPTV-DRISYLPDSILCHILSFVPTKLAAITSVLSKRWEQVWLSV 85 >XP_003622277.1 cyclin-like F-box protein [Medicago truncatula] AES78495.1 cyclin-like F-box protein [Medicago truncatula] Length = 356 Score = 72.0 bits (175), Expect = 2e-12 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = -2 Query: 137 LPTMADRISTLPDSILCHILSYLPTKLAVATSILSRRWRPLWLSV 3 +PT+ DR+S LPDS++CHILS+LPTK + ATSILS+RW PLWLSV Sbjct: 7 IPTV-DRVSVLPDSVICHILSFLPTKESAATSILSKRWNPLWLSV 50 >KRG99696.1 hypothetical protein GLYMA_18G164400 [Glycine max] Length = 372 Score = 72.0 bits (175), Expect = 2e-12 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = -2 Query: 128 MADRISTLPDSILCHILSYLPTKLAVATSILSRRWRPLWLSV 3 MADRIS+LPD++LCHILS+LPT +VATS+LS+RWRPLW SV Sbjct: 1 MADRISSLPDTLLCHILSFLPTIESVATSVLSKRWRPLWRSV 42 >ABN05919.1 Cyclin-like F-box; FBD [Medicago truncatula] Length = 248 Score = 70.9 bits (172), Expect = 3e-12 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -2 Query: 122 DRISTLPDSILCHILSYLPTKLAVATSILSRRWRPLWLSV 3 DR S+LPDSI+CHILS+LPTK VATSILS+RW+PLWLSV Sbjct: 18 DRDSSLPDSIICHILSFLPTKDTVATSILSKRWKPLWLSV 57 >XP_003624289.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] AES80507.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] Length = 256 Score = 70.9 bits (172), Expect = 3e-12 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -2 Query: 122 DRISTLPDSILCHILSYLPTKLAVATSILSRRWRPLWLSV 3 DR S+LPDSI+CHILS+LPTK VATSILS+RW+PLWLSV Sbjct: 18 DRDSSLPDSIICHILSFLPTKDTVATSILSKRWKPLWLSV 57 >XP_014626130.1 PREDICTED: FBD-associated F-box protein At4g10400-like [Glycine max] Length = 559 Score = 72.0 bits (175), Expect = 3e-12 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = -2 Query: 128 MADRISTLPDSILCHILSYLPTKLAVATSILSRRWRPLWLSV 3 MADRIS+LPD++LCHILS+LPT +VATS+LS+RWRPLW SV Sbjct: 1 MADRISSLPDTLLCHILSFLPTIESVATSVLSKRWRPLWRSV 42 >XP_013450532.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] KEH24560.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] Length = 399 Score = 71.6 bits (174), Expect = 4e-12 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -2 Query: 137 LPTMADRISTLPDSILCHILSYLPTKLAVATSILSRRWRPLWLSV 3 +PT DRIS+ PD I+CHILS+LPTKL+ ATSILS+RW PLWLSV Sbjct: 8 IPT-EDRISSFPDHIICHILSFLPTKLSAATSILSKRWNPLWLSV 51 >XP_003599617.1 cyclin-like F-box protein [Medicago truncatula] AES69868.1 cyclin-like F-box protein [Medicago truncatula] Length = 363 Score = 71.2 bits (173), Expect = 4e-12 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -2 Query: 125 ADRISTLPDSILCHILSYLPTKLAVATSILSRRWRPLWLSV 3 ADRIS LPDSILCHILS++ TK A TS+LS+RWRPLWLSV Sbjct: 4 ADRISNLPDSILCHILSFISTKQAAITSVLSKRWRPLWLSV 44 >GAU13045.1 hypothetical protein TSUD_173450 [Trifolium subterraneum] Length = 343 Score = 70.9 bits (172), Expect = 6e-12 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -2 Query: 137 LPTMADRISTLPDSILCHILSYLPTKLAVATSILSRRWRPLWLSV 3 +PT DRIS LPDS++CHILS+LPTK +V T+ILS+RW PLWLSV Sbjct: 7 IPT-EDRISALPDSVICHILSFLPTKQSVTTTILSKRWNPLWLSV 50 >GAU30177.1 hypothetical protein TSUD_311280 [Trifolium subterraneum] Length = 348 Score = 70.9 bits (172), Expect = 6e-12 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -2 Query: 128 MADRISTLPDSILCHILSYLPTKLAVATSILSRRWRPLWLSV 3 M D IS LPDSILCH+LS+LPTKL+ TSILS+RW+PLWLS+ Sbjct: 14 MEDIISILPDSILCHVLSFLPTKLSATTSILSKRWKPLWLSL 55