BLASTX nr result
ID: Glycyrrhiza33_contig00007012
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00007012 (519 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003602315.2 OPT family oligopeptide transporter [Medicago tru... 135 8e-34 XP_012571953.1 PREDICTED: metal-nicotianamine transporter YSL3 [... 133 5e-33 XP_006581667.1 PREDICTED: metal-nicotianamine transporter YSL3-l... 125 3e-30 XP_016187204.1 PREDICTED: metal-nicotianamine transporter YSL3 [... 117 3e-30 XP_018818779.1 PREDICTED: metal-nicotianamine transporter YSL3 [... 125 4e-30 XP_007136481.1 hypothetical protein PHAVU_009G048800g [Phaseolus... 124 5e-30 KYP50603.1 Metal-nicotianamine transporter YSL3 [Cajanus cajan] 123 1e-29 XP_014518336.1 PREDICTED: metal-nicotianamine transporter YSL3 [... 122 5e-29 XP_017421572.1 PREDICTED: metal-nicotianamine transporter YSL3 [... 122 5e-29 XP_006578879.1 PREDICTED: metal-nicotianamine transporter YSL3-l... 121 7e-29 KHN19530.1 Metal-nicotianamine transporter YSL3 [Glycine soja] 121 7e-29 XP_003523338.2 PREDICTED: metal-nicotianamine transporter YSL3-l... 121 7e-29 XP_016715498.1 PREDICTED: metal-nicotianamine transporter YSL3-l... 121 9e-29 XP_012471173.1 PREDICTED: metal-nicotianamine transporter YSL3-l... 121 9e-29 OAY59527.1 hypothetical protein MANES_01G038100 [Manihot esculenta] 120 2e-28 OMO97826.1 Oligopeptide transporter OPT superfamily [Corchorus o... 120 2e-28 KGN65329.1 hypothetical protein Csa_1G329900 [Cucumis sativus] 119 3e-28 XP_004150025.2 PREDICTED: metal-nicotianamine transporter YSL3 [... 119 3e-28 AFU82909.1 yellow stripe-like transporter 3.2, partial [Arachis ... 114 3e-28 XP_018842804.1 PREDICTED: metal-nicotianamine transporter YSL3-l... 118 5e-28 >XP_003602315.2 OPT family oligopeptide transporter [Medicago truncatula] AES72566.2 OPT family oligopeptide transporter [Medicago truncatula] Length = 667 Score = 135 bits (340), Expect = 8e-34 Identities = 64/66 (96%), Positives = 65/66 (98%) Frame = -1 Query: 519 YFAIDMCMGSLVVFAWHTLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 340 YFAIDMC+GSLVVFAWH LNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM Sbjct: 602 YFAIDMCVGSLVVFAWHMLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 661 Query: 339 SFFPSR 322 SFFPSR Sbjct: 662 SFFPSR 667 >XP_012571953.1 PREDICTED: metal-nicotianamine transporter YSL3 [Cicer arietinum] XP_012571954.1 PREDICTED: metal-nicotianamine transporter YSL3 [Cicer arietinum] Length = 674 Score = 133 bits (334), Expect = 5e-33 Identities = 61/66 (92%), Positives = 64/66 (96%) Frame = -1 Query: 519 YFAIDMCMGSLVVFAWHTLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 340 YFAIDMCMGSL+VFAWH LNK EAGLMVPA+ASGLICGDGLWILPSSILALLKVRPPICM Sbjct: 609 YFAIDMCMGSLIVFAWHILNKNEAGLMVPAIASGLICGDGLWILPSSILALLKVRPPICM 668 Query: 339 SFFPSR 322 SFFPS+ Sbjct: 669 SFFPSK 674 >XP_006581667.1 PREDICTED: metal-nicotianamine transporter YSL3-like [Glycine max] XP_006581668.1 PREDICTED: metal-nicotianamine transporter YSL3-like [Glycine max] XP_003527996.2 PREDICTED: metal-nicotianamine transporter YSL3-like [Glycine max] KHN23328.1 Metal-nicotianamine transporter YSL3 [Glycine soja] KRH53576.1 hypothetical protein GLYMA_06G133000 [Glycine max] KRH53577.1 hypothetical protein GLYMA_06G133000 [Glycine max] KRH53578.1 hypothetical protein GLYMA_06G133000 [Glycine max] Length = 676 Score = 125 bits (314), Expect = 3e-30 Identities = 58/62 (93%), Positives = 60/62 (96%) Frame = -1 Query: 519 YFAIDMCMGSLVVFAWHTLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 340 YFAIDMCMGSLVVF WHTLN+ EAGLMVPAVASGLICGDGLWILPSSILALLK+RPPICM Sbjct: 609 YFAIDMCMGSLVVFLWHTLNRNEAGLMVPAVASGLICGDGLWILPSSILALLKIRPPICM 668 Query: 339 SF 334 SF Sbjct: 669 SF 670 >XP_016187204.1 PREDICTED: metal-nicotianamine transporter YSL3 [Arachis ipaensis] Length = 187 Score = 117 bits (294), Expect = 3e-30 Identities = 53/66 (80%), Positives = 60/66 (90%) Frame = -1 Query: 519 YFAIDMCMGSLVVFAWHTLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 340 YFAIDMC+GSL+V++WHTL +EA LMVPAVASGLICGDGLWILPSS+LAL VRPPICM Sbjct: 122 YFAIDMCVGSLIVYSWHTLKSEEANLMVPAVASGLICGDGLWILPSSLLALFGVRPPICM 181 Query: 339 SFFPSR 322 SFF S+ Sbjct: 182 SFFTSK 187 >XP_018818779.1 PREDICTED: metal-nicotianamine transporter YSL3 [Juglans regia] Length = 666 Score = 125 bits (313), Expect = 4e-30 Identities = 57/66 (86%), Positives = 61/66 (92%) Frame = -1 Query: 519 YFAIDMCMGSLVVFAWHTLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 340 YFAIDMCMGSL+VFAWH LN K+A LMVPAVASGLICGDGLWILPSSILAL K+ PPICM Sbjct: 601 YFAIDMCMGSLIVFAWHKLNGKQASLMVPAVASGLICGDGLWILPSSILALAKIHPPICM 660 Query: 339 SFFPSR 322 +FFPSR Sbjct: 661 NFFPSR 666 >XP_007136481.1 hypothetical protein PHAVU_009G048800g [Phaseolus vulgaris] XP_007136482.1 hypothetical protein PHAVU_009G048800g [Phaseolus vulgaris] ESW08475.1 hypothetical protein PHAVU_009G048800g [Phaseolus vulgaris] ESW08476.1 hypothetical protein PHAVU_009G048800g [Phaseolus vulgaris] Length = 673 Score = 124 bits (312), Expect = 5e-30 Identities = 59/62 (95%), Positives = 59/62 (95%) Frame = -1 Query: 519 YFAIDMCMGSLVVFAWHTLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 340 YFAIDMCMGSLVVF WH LNK EAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM Sbjct: 606 YFAIDMCMGSLVVFMWHKLNKSEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 665 Query: 339 SF 334 SF Sbjct: 666 SF 667 >KYP50603.1 Metal-nicotianamine transporter YSL3 [Cajanus cajan] Length = 571 Score = 123 bits (308), Expect = 1e-29 Identities = 58/66 (87%), Positives = 60/66 (90%) Frame = -1 Query: 519 YFAIDMCMGSLVVFAWHTLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 340 YFAIDMCMGSLVVF WHTLN EA LMVPAVASGLICGDGLWILPSSILALLK+RPPICM Sbjct: 506 YFAIDMCMGSLVVFIWHTLNTNEARLMVPAVASGLICGDGLWILPSSILALLKIRPPICM 565 Query: 339 SFFPSR 322 SF +R Sbjct: 566 SFLSAR 571 >XP_014518336.1 PREDICTED: metal-nicotianamine transporter YSL3 [Vigna radiata var. radiata] XP_014518337.1 PREDICTED: metal-nicotianamine transporter YSL3 [Vigna radiata var. radiata] XP_014518338.1 PREDICTED: metal-nicotianamine transporter YSL3 [Vigna radiata var. radiata] Length = 676 Score = 122 bits (305), Expect = 5e-29 Identities = 58/65 (89%), Positives = 58/65 (89%) Frame = -1 Query: 519 YFAIDMCMGSLVVFAWHTLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 340 YFAIDMCMGSLVVF WH LNK EA LMVPA ASGLICGDGLWILPSSILALLKVRPPICM Sbjct: 609 YFAIDMCMGSLVVFMWHKLNKSEASLMVPAAASGLICGDGLWILPSSILALLKVRPPICM 668 Query: 339 SFFPS 325 SF S Sbjct: 669 SFLSS 673 >XP_017421572.1 PREDICTED: metal-nicotianamine transporter YSL3 [Vigna angularis] XP_017421573.1 PREDICTED: metal-nicotianamine transporter YSL3 [Vigna angularis] KOM40635.1 hypothetical protein LR48_Vigan04g083300 [Vigna angularis] BAT78879.1 hypothetical protein VIGAN_02163400 [Vigna angularis var. angularis] Length = 676 Score = 122 bits (305), Expect = 5e-29 Identities = 58/65 (89%), Positives = 58/65 (89%) Frame = -1 Query: 519 YFAIDMCMGSLVVFAWHTLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 340 YFAIDMCMGSLVVF WH LNK EA LMVPA ASGLICGDGLWILPSSILALLKVRPPICM Sbjct: 609 YFAIDMCMGSLVVFMWHKLNKSEASLMVPAAASGLICGDGLWILPSSILALLKVRPPICM 668 Query: 339 SFFPS 325 SF S Sbjct: 669 SFLSS 673 >XP_006578879.1 PREDICTED: metal-nicotianamine transporter YSL3-like isoform X2 [Glycine max] XP_006578880.1 PREDICTED: metal-nicotianamine transporter YSL3-like isoform X2 [Glycine max] KRH64357.1 hypothetical protein GLYMA_04G231900 [Glycine max] KRH64358.1 hypothetical protein GLYMA_04G231900 [Glycine max] Length = 676 Score = 121 bits (304), Expect = 7e-29 Identities = 56/62 (90%), Positives = 58/62 (93%) Frame = -1 Query: 519 YFAIDMCMGSLVVFAWHTLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 340 YFAIDMCMGSLVVF WH LN+ EAGLMVPAVASGLICGDGLWILPSSILAL K+RPPICM Sbjct: 609 YFAIDMCMGSLVVFLWHKLNRNEAGLMVPAVASGLICGDGLWILPSSILALFKIRPPICM 668 Query: 339 SF 334 SF Sbjct: 669 SF 670 >KHN19530.1 Metal-nicotianamine transporter YSL3 [Glycine soja] Length = 687 Score = 121 bits (304), Expect = 7e-29 Identities = 56/62 (90%), Positives = 58/62 (93%) Frame = -1 Query: 519 YFAIDMCMGSLVVFAWHTLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 340 YFAIDMCMGSLVVF WH LN+ EAGLMVPAVASGLICGDGLWILPSSILAL K+RPPICM Sbjct: 620 YFAIDMCMGSLVVFLWHKLNRNEAGLMVPAVASGLICGDGLWILPSSILALFKIRPPICM 679 Query: 339 SF 334 SF Sbjct: 680 SF 681 >XP_003523338.2 PREDICTED: metal-nicotianamine transporter YSL3-like isoform X1 [Glycine max] Length = 687 Score = 121 bits (304), Expect = 7e-29 Identities = 56/62 (90%), Positives = 58/62 (93%) Frame = -1 Query: 519 YFAIDMCMGSLVVFAWHTLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 340 YFAIDMCMGSLVVF WH LN+ EAGLMVPAVASGLICGDGLWILPSSILAL K+RPPICM Sbjct: 620 YFAIDMCMGSLVVFLWHKLNRNEAGLMVPAVASGLICGDGLWILPSSILALFKIRPPICM 679 Query: 339 SF 334 SF Sbjct: 680 SF 681 >XP_016715498.1 PREDICTED: metal-nicotianamine transporter YSL3-like [Gossypium hirsutum] XP_016715499.1 PREDICTED: metal-nicotianamine transporter YSL3-like [Gossypium hirsutum] Length = 662 Score = 121 bits (303), Expect = 9e-29 Identities = 57/65 (87%), Positives = 60/65 (92%) Frame = -1 Query: 519 YFAIDMCMGSLVVFAWHTLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 340 YFAIDMC+GSLVVFAWH LN K+A LMVPAVASGLICGDGLW+LPSSILAL KVRPPICM Sbjct: 597 YFAIDMCVGSLVVFAWHKLNGKKADLMVPAVASGLICGDGLWLLPSSILALFKVRPPICM 656 Query: 339 SFFPS 325 SFF S Sbjct: 657 SFFAS 661 >XP_012471173.1 PREDICTED: metal-nicotianamine transporter YSL3-like [Gossypium raimondii] XP_012471174.1 PREDICTED: metal-nicotianamine transporter YSL3-like [Gossypium raimondii] KJB19873.1 hypothetical protein B456_003G122700 [Gossypium raimondii] Length = 665 Score = 121 bits (303), Expect = 9e-29 Identities = 57/65 (87%), Positives = 60/65 (92%) Frame = -1 Query: 519 YFAIDMCMGSLVVFAWHTLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 340 YFAIDMC+GSLVVFAWH LN K+A LMVPAVASGLICGDGLW+LPSSILAL KVRPPICM Sbjct: 600 YFAIDMCVGSLVVFAWHKLNGKKADLMVPAVASGLICGDGLWLLPSSILALFKVRPPICM 659 Query: 339 SFFPS 325 SFF S Sbjct: 660 SFFAS 664 >OAY59527.1 hypothetical protein MANES_01G038100 [Manihot esculenta] Length = 667 Score = 120 bits (301), Expect = 2e-28 Identities = 55/62 (88%), Positives = 58/62 (93%) Frame = -1 Query: 519 YFAIDMCMGSLVVFAWHTLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 340 YFAIDMCMGSL+VFAWH LN K+AGLMVPAVASGLICGDGLWILPSSILAL K+ PPICM Sbjct: 605 YFAIDMCMGSLIVFAWHKLNSKKAGLMVPAVASGLICGDGLWILPSSILALAKIHPPICM 664 Query: 339 SF 334 SF Sbjct: 665 SF 666 >OMO97826.1 Oligopeptide transporter OPT superfamily [Corchorus olitorius] Length = 668 Score = 120 bits (300), Expect = 2e-28 Identities = 55/62 (88%), Positives = 59/62 (95%) Frame = -1 Query: 519 YFAIDMCMGSLVVFAWHTLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 340 YFAIDMC+GSLVVFAWH LN K+AGLM+PAVASGLICGDGLW+LPSSILAL KVRPPICM Sbjct: 604 YFAIDMCVGSLVVFAWHKLNGKKAGLMIPAVASGLICGDGLWLLPSSILALFKVRPPICM 663 Query: 339 SF 334 SF Sbjct: 664 SF 665 >KGN65329.1 hypothetical protein Csa_1G329900 [Cucumis sativus] Length = 617 Score = 119 bits (299), Expect = 3e-28 Identities = 54/65 (83%), Positives = 60/65 (92%) Frame = -1 Query: 519 YFAIDMCMGSLVVFAWHTLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 340 YFAIDMCMGSL+VF WH LN+++AGLMVPAVASGLICG+GLWILPSSILAL K+ PPICM Sbjct: 550 YFAIDMCMGSLIVFVWHYLNREKAGLMVPAVASGLICGEGLWILPSSILALAKIHPPICM 609 Query: 339 SFFPS 325 SFF S Sbjct: 610 SFFSS 614 >XP_004150025.2 PREDICTED: metal-nicotianamine transporter YSL3 [Cucumis sativus] Length = 670 Score = 119 bits (299), Expect = 3e-28 Identities = 54/65 (83%), Positives = 60/65 (92%) Frame = -1 Query: 519 YFAIDMCMGSLVVFAWHTLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 340 YFAIDMCMGSL+VF WH LN+++AGLMVPAVASGLICG+GLWILPSSILAL K+ PPICM Sbjct: 603 YFAIDMCMGSLIVFVWHYLNREKAGLMVPAVASGLICGEGLWILPSSILALAKIHPPICM 662 Query: 339 SFFPS 325 SFF S Sbjct: 663 SFFSS 667 >AFU82909.1 yellow stripe-like transporter 3.2, partial [Arachis hypogaea] Length = 263 Score = 114 bits (286), Expect = 3e-28 Identities = 53/66 (80%), Positives = 58/66 (87%) Frame = -1 Query: 519 YFAIDMCMGSLVVFAWHTLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 340 YFAIDMC+GSLVV+AWH L +EA LMVPAVASGLICGDGLWILPSSILAL V PP+CM Sbjct: 198 YFAIDMCVGSLVVYAWHKLKSEEASLMVPAVASGLICGDGLWILPSSILALFGVHPPMCM 257 Query: 339 SFFPSR 322 SFF S+ Sbjct: 258 SFFSSK 263 >XP_018842804.1 PREDICTED: metal-nicotianamine transporter YSL3-like isoform X4 [Juglans regia] Length = 553 Score = 118 bits (296), Expect = 5e-28 Identities = 54/66 (81%), Positives = 58/66 (87%) Frame = -1 Query: 519 YFAIDMCMGSLVVFAWHTLNKKEAGLMVPAVASGLICGDGLWILPSSILALLKVRPPICM 340 YFAIDMC+GSL+ FAWH LN K+A LMVPA ASGLICGDGLWILPSSILAL +RPP CM Sbjct: 488 YFAIDMCVGSLIAFAWHKLNGKKANLMVPAAASGLICGDGLWILPSSILALANIRPPNCM 547 Query: 339 SFFPSR 322 SFFPSR Sbjct: 548 SFFPSR 553