BLASTX nr result
ID: Glycyrrhiza33_contig00006514
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00006514 (395 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_009040365.1 hypothetical protein [Hyoscyamus niger] AGU46513.... 91 4e-21 YP_004891653.1 unnamed protein product (chloroplast) [Nicotiana ... 91 4e-21 YP_004891654.1 unnamed protein product (chloroplast) [Nicotiana ... 85 4e-19 YP_002720156.1 ORF126 [Jatropha curcas] YP_002720173.1 ORF126 [J... 86 5e-19 XP_002888391.1 hypothetical protein ARALYDRAFT_894061 [Arabidops... 56 6e-08 CDY45543.1 BnaCnng13020D [Brassica napus] CDY19675.1 BnaC09g2931... 56 3e-07 YP_001109573.1 hypothetical protein Poptr_cp096 [Populus trichoc... 53 7e-07 >YP_009040365.1 hypothetical protein [Hyoscyamus niger] AGU46513.1 hypothetical protein (plastid) [Hyoscyamus niger] Length = 115 Score = 90.9 bits (224), Expect = 4e-21 Identities = 52/88 (59%), Positives = 58/88 (65%), Gaps = 4/88 (4%) Frame = +1 Query: 118 NWNKFGSGSKNLGDLLYLMNGESVLKSSA----PPYMLQQKSHRGRLI*YNRNLC*NAQP 285 NWNKFGSGS+NLGDLLYLMNGES LKSSA P YMLQQ+SH+GRL + P Sbjct: 24 NWNKFGSGSRNLGDLLYLMNGESALKSSALHPPPEYMLQQESHKGRLETSGK------MP 77 Query: 286 *TNG*STLHSPF*GLATYPFNAFGTRHS 369 N +H GLATYPF+ FGT S Sbjct: 78 ARNPADKVHYIVEGLATYPFSDFGTGRS 105 >YP_004891653.1 unnamed protein product (chloroplast) [Nicotiana undulata] YP_004891682.1 unnamed protein product (chloroplast) [Nicotiana undulata] CAA77388.1 hypothetical protein (chloroplast) [Nicotiana tabacum] CAA77405.1 hypothetical protein (chloroplast) [Nicotiana tabacum] BAE46700.1 hypothetical protein (chloroplast) [Nicotiana sylvestris] BAE46730.1 hypothetical protein (chloroplast) [Nicotiana sylvestris] BAE48049.1 hypothetical protein (chloroplast) [Nicotiana tomentosiformis] BAE48079.1 hypothetical protein (chloroplast) [Nicotiana tomentosiformis] AEO95591.1 hypothetical protein (chloroplast) [Nicotiana undulata] AEO95639.1 hypothetical protein (chloroplast) [Nicotiana undulata] AEO95701.1 hypothetical protein [synthetic construct] AEO95747.1 hypothetical protein [synthetic construct] prf||1211235CC ORF 115 Length = 115 Score = 90.9 bits (224), Expect = 4e-21 Identities = 52/88 (59%), Positives = 58/88 (65%), Gaps = 4/88 (4%) Frame = +1 Query: 118 NWNKFGSGSKNLGDLLYLMNGESVLKSSA----PPYMLQQKSHRGRLI*YNRNLC*NAQP 285 NWNKFGSGS+NLGDLLYLMNGES LKSSA P YMLQQ+SH+GRL + P Sbjct: 24 NWNKFGSGSRNLGDLLYLMNGESALKSSALHPPPEYMLQQESHKGRLETSGK------MP 77 Query: 286 *TNG*STLHSPF*GLATYPFNAFGTRHS 369 N +H GLATYPF+ FGT S Sbjct: 78 ARNPADKVHYIVQGLATYPFSDFGTGRS 105 >YP_004891654.1 unnamed protein product (chloroplast) [Nicotiana undulata] YP_004891683.1 unnamed protein product (chloroplast) [Nicotiana undulata] CAA77387.1 hypothetical protein (chloroplast) [Nicotiana tabacum] CAA77406.1 hypothetical protein (chloroplast) [Nicotiana tabacum] BAE46701.1 hypothetical protein (chloroplast) [Nicotiana sylvestris] BAE46731.1 hypothetical protein (chloroplast) [Nicotiana sylvestris] BAE48050.1 hypothetical protein (chloroplast) [Nicotiana tomentosiformis] BAE48080.1 hypothetical protein (chloroplast) [Nicotiana tomentosiformis] AEO95592.1 hypothetical protein (chloroplast) [Nicotiana undulata] AEO95640.1 hypothetical protein (chloroplast) [Nicotiana undulata] AEO95702.1 hypothetical protein [synthetic construct] AEO95748.1 hypothetical protein [synthetic construct] prf||1211235CD ORF 92 Length = 92 Score = 85.1 bits (209), Expect = 4e-19 Identities = 49/80 (61%), Positives = 53/80 (66%), Gaps = 4/80 (5%) Frame = -2 Query: 343 MGKSPIPKTDYVMYFIRWFMVGHFNRGFYCIISIYPCVISVEAY-RG---GQTISKRTLH 176 MGKSPIP V+Y + + R FY IYPCVI VEAY RG G+TI KRT H Sbjct: 1 MGKSPIPGLCNVLYLLG------YGRAFYQRFLIYPCVIPVEAYTRGVGAGRTILKRTPH 54 Query: 175 SLDREDHQDFLIRCRTYSNS 116 SLDREDHQDF IRCR YSNS Sbjct: 55 SLDREDHQDFAIRCRIYSNS 74 >YP_002720156.1 ORF126 [Jatropha curcas] YP_002720173.1 ORF126 [Jatropha curcas] ACN72735.1 ORF126 (chloroplast) [Jatropha curcas] ACN72751.1 ORF126 (chloroplast) [Jatropha curcas] Length = 126 Score = 85.9 bits (211), Expect = 5e-19 Identities = 41/56 (73%), Positives = 44/56 (78%) Frame = +2 Query: 203 PPPICFNRNHTGVD*YDTIETSVKMPNHKPTDKVHYIVRFRDWRLTHSMPLVPDIP 370 PP ICFNRN+T V DTIETS KMP PTDKVHYIVRFRDWRLTHS+ L D+P Sbjct: 15 PPSICFNRNYTRV--VDTIETSGKMPARNPTDKVHYIVRFRDWRLTHSVTLALDVP 68 >XP_002888391.1 hypothetical protein ARALYDRAFT_894061 [Arabidopsis lyrata subsp. lyrata] EFH64650.1 hypothetical protein ARALYDRAFT_894061 [Arabidopsis lyrata subsp. lyrata] Length = 70 Score = 55.8 bits (133), Expect = 6e-08 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 2/34 (5%) Frame = +1 Query: 109 LLLNWNKFGSGSKNLGDLLYLMNGE--SVLKSSA 204 ++L WNKFGSGS+NLGDLLYLMNGE S LKSSA Sbjct: 23 IILKWNKFGSGSRNLGDLLYLMNGEGKSALKSSA 56 >CDY45543.1 BnaCnng13020D [Brassica napus] CDY19675.1 BnaC09g29310D [Brassica napus] CDX95211.1 BnaC09g16590D [Brassica napus] Length = 148 Score = 55.8 bits (133), Expect = 3e-07 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 2/34 (5%) Frame = +1 Query: 109 LLLNWNKFGSGSKNLGDLLYLMN--GESVLKSSA 204 ++L WNKFGSGS+NLGDLLYLMN GES LKSSA Sbjct: 36 IILKWNKFGSGSRNLGDLLYLMNGEGESALKSSA 69 >YP_001109573.1 hypothetical protein Poptr_cp096 [Populus trichocarpa] ABO36777.1 conserved hypothetical protein (chloroplast) [Populus trichocarpa] Length = 71 Score = 53.1 bits (126), Expect = 7e-07 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = +1 Query: 106 DLLLNWNKFGSGSKNLGDLLYLMNGE 183 DLLLNWNKFG GS+NLGDLLYLMN E Sbjct: 21 DLLLNWNKFGRGSRNLGDLLYLMNNE 46