BLASTX nr result
ID: Glycyrrhiza33_contig00006440
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00006440 (601 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014512092.1 PREDICTED: uncharacterized protein LOC106770798 [... 71 2e-13 XP_007162403.1 hypothetical protein PHAVU_001G149100g [Phaseolus... 69 4e-12 XP_017416742.1 PREDICTED: uncharacterized protein LOC108327562 [... 67 9e-12 XP_006588622.1 PREDICTED: uncharacterized protein LOC102659834 [... 67 1e-11 XP_007144608.1 hypothetical protein PHAVU_007G169700g [Phaseolus... 67 1e-11 KYP71562.1 hypothetical protein KK1_010826, partial [Cajanus cajan] 67 1e-11 BAT85418.1 hypothetical protein VIGAN_04296200, partial [Vigna a... 67 2e-11 OAY61692.1 hypothetical protein MANES_01G209600 [Manihot esculenta] 66 2e-11 XP_015583230.1 PREDICTED: uncharacterized protein LOC107262365 [... 66 2e-11 XP_017191210.1 PREDICTED: uncharacterized protein LOC108174586 [... 66 3e-11 KRH67170.1 hypothetical protein GLYMA_03G151600 [Glycine max] 67 3e-11 XP_002320393.1 hypothetical protein POPTR_0014s13500g [Populus t... 66 4e-11 XP_018503043.1 PREDICTED: uncharacterized protein LOC108867256 [... 65 4e-11 XP_018847430.1 PREDICTED: uncharacterized protein LOC109010918 [... 64 9e-11 OAY49672.1 hypothetical protein MANES_05G073900 [Manihot esculenta] 64 9e-11 XP_016900743.1 PREDICTED: uncharacterized protein LOC107991010 [... 64 1e-10 XP_017969444.1 PREDICTED: uncharacterized protein LOC18613395 [T... 64 1e-10 XP_019071153.1 PREDICTED: uncharacterized protein LOC109121105 [... 64 2e-10 XP_012092285.1 PREDICTED: uncharacterized protein LOC105650027 [... 63 2e-10 KJB23129.1 hypothetical protein B456_004G082900, partial [Gossyp... 64 3e-10 >XP_014512092.1 PREDICTED: uncharacterized protein LOC106770798 [Vigna radiata var. radiata] Length = 45 Score = 71.2 bits (173), Expect = 2e-13 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 133 WGRCSKQVRQQRTRLYIIWRCAVLLLCWHD 222 WGRCSKQVRQQRTRLYIIWRC VLLLCWHD Sbjct: 16 WGRCSKQVRQQRTRLYIIWRCTVLLLCWHD 45 >XP_007162403.1 hypothetical protein PHAVU_001G149100g [Phaseolus vulgaris] ESW34397.1 hypothetical protein PHAVU_001G149100g [Phaseolus vulgaris] Length = 70 Score = 68.6 bits (166), Expect = 4e-12 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 133 WGRCSKQVRQQRTRLYIIWRCAVLLLCWHD 222 WGRCSK +RQQRTRLYIIWRC VLLLCWHD Sbjct: 41 WGRCSKYIRQQRTRLYIIWRCTVLLLCWHD 70 >XP_017416742.1 PREDICTED: uncharacterized protein LOC108327562 [Vigna angularis] Length = 48 Score = 67.0 bits (162), Expect = 9e-12 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 133 WGRCSKQVRQQRTRLYIIWRCAVLLLCWHD 222 WGRCSK +RQQRTRLYIIWRC VLLLCWH+ Sbjct: 19 WGRCSKYIRQQRTRLYIIWRCTVLLLCWHE 48 >XP_006588622.1 PREDICTED: uncharacterized protein LOC102659834 [Glycine max] KRH31994.1 hypothetical protein GLYMA_10G024900 [Glycine max] Length = 45 Score = 66.6 bits (161), Expect = 1e-11 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 133 WGRCSKQVRQQRTRLYIIWRCAVLLLCWHD 222 W RCSKQVRQQRTRLYIIWRC VLLLCWH+ Sbjct: 16 WERCSKQVRQQRTRLYIIWRCTVLLLCWHE 45 >XP_007144608.1 hypothetical protein PHAVU_007G169700g [Phaseolus vulgaris] ESW16602.1 hypothetical protein PHAVU_007G169700g [Phaseolus vulgaris] Length = 45 Score = 66.6 bits (161), Expect = 1e-11 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 133 WGRCSKQVRQQRTRLYIIWRCAVLLLCWHD 222 W RCSKQVRQQRTRLYIIWRC VLLLCWH+ Sbjct: 16 WERCSKQVRQQRTRLYIIWRCTVLLLCWHE 45 >KYP71562.1 hypothetical protein KK1_010826, partial [Cajanus cajan] Length = 55 Score = 66.6 bits (161), Expect = 1e-11 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 133 WGRCSKQVRQQRTRLYIIWRCAVLLLCWHD 222 W RCSKQVRQQRTRLYIIWRC VLLLCWH+ Sbjct: 26 WERCSKQVRQQRTRLYIIWRCTVLLLCWHE 55 >BAT85418.1 hypothetical protein VIGAN_04296200, partial [Vigna angularis var. angularis] Length = 70 Score = 67.0 bits (162), Expect = 2e-11 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 133 WGRCSKQVRQQRTRLYIIWRCAVLLLCWHD 222 WGRCSK +RQQRTRLYIIWRC VLLLCWH+ Sbjct: 41 WGRCSKYIRQQRTRLYIIWRCTVLLLCWHE 70 >OAY61692.1 hypothetical protein MANES_01G209600 [Manihot esculenta] Length = 45 Score = 66.2 bits (160), Expect = 2e-11 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 133 WGRCSKQVRQQRTRLYIIWRCAVLLLCWHD 222 W RCSKQVR+QRTRLYIIWRC V+LLCWHD Sbjct: 16 WQRCSKQVREQRTRLYIIWRCTVMLLCWHD 45 >XP_015583230.1 PREDICTED: uncharacterized protein LOC107262365 [Ricinus communis] Length = 45 Score = 65.9 bits (159), Expect = 2e-11 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 133 WGRCSKQVRQQRTRLYIIWRCAVLLLCWHD 222 W RCSKQ+R+QRTRLYIIWRC V+LLCWHD Sbjct: 16 WHRCSKQIREQRTRLYIIWRCTVMLLCWHD 45 >XP_017191210.1 PREDICTED: uncharacterized protein LOC108174586 [Malus domestica] Length = 51 Score = 65.9 bits (159), Expect = 3e-11 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +1 Query: 133 WGRCSKQVRQQRTRLYIIWRCAVLLLCWHD 222 WGRCSKQ+R+QR RLYIIWRC+V+LLCWH+ Sbjct: 22 WGRCSKQIREQRARLYIIWRCSVMLLCWHE 51 >KRH67170.1 hypothetical protein GLYMA_03G151600 [Glycine max] Length = 102 Score = 67.0 bits (162), Expect = 3e-11 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 133 WGRCSKQVRQQRTRLYIIWRCAVLLLCWHD 222 WGRCSK +RQQRTRLYIIWRC VLLLCWH+ Sbjct: 73 WGRCSKYIRQQRTRLYIIWRCTVLLLCWHE 102 >XP_002320393.1 hypothetical protein POPTR_0014s13500g [Populus trichocarpa] EEE98708.1 hypothetical protein POPTR_0014s13500g [Populus trichocarpa] Length = 64 Score = 65.9 bits (159), Expect = 4e-11 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 133 WGRCSKQVRQQRTRLYIIWRCAVLLLCWHD 222 W RCSKQ+R+QRTRLYIIWRC V+LLCWHD Sbjct: 35 WQRCSKQIREQRTRLYIIWRCTVMLLCWHD 64 >XP_018503043.1 PREDICTED: uncharacterized protein LOC108867256 [Pyrus x bretschneideri] Length = 52 Score = 65.5 bits (158), Expect = 4e-11 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 133 WGRCSKQVRQQRTRLYIIWRCAVLLLCWHD 222 WGRCSKQ+R+QR RLYIIWRC V+LLCWH+ Sbjct: 23 WGRCSKQIREQRARLYIIWRCTVMLLCWHE 52 >XP_018847430.1 PREDICTED: uncharacterized protein LOC109010918 [Juglans regia] Length = 45 Score = 64.3 bits (155), Expect = 9e-11 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 133 WGRCSKQVRQQRTRLYIIWRCAVLLLCWHD 222 W RCSKQ R+QR RLYIIWRCAV+LLCWHD Sbjct: 16 WHRCSKQAREQRARLYIIWRCAVILLCWHD 45 >OAY49672.1 hypothetical protein MANES_05G073900 [Manihot esculenta] Length = 47 Score = 64.3 bits (155), Expect = 9e-11 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 133 WGRCSKQVRQQRTRLYIIWRCAVLLLCWHD 222 W RCSKQ+R+QRTRLYIIWRC V+LLCWH+ Sbjct: 18 WQRCSKQIREQRTRLYIIWRCTVMLLCWHE 47 >XP_016900743.1 PREDICTED: uncharacterized protein LOC107991010 [Cucumis melo] Length = 38 Score = 63.9 bits (154), Expect = 1e-10 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 133 WGRCSKQVRQQRTRLYIIWRCAVLLLCWHD 222 W +CSKQ+R+QR RLYIIWRCAV+LLCWHD Sbjct: 9 WQQCSKQIREQRARLYIIWRCAVMLLCWHD 38 >XP_017969444.1 PREDICTED: uncharacterized protein LOC18613395 [Theobroma cacao] Length = 45 Score = 63.9 bits (154), Expect = 1e-10 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 133 WGRCSKQVRQQRTRLYIIWRCAVLLLCWHD 222 W RCSKQ+R+QR RLYIIWRC VLLLCWHD Sbjct: 16 WQRCSKQIREQRGRLYIIWRCTVLLLCWHD 45 >XP_019071153.1 PREDICTED: uncharacterized protein LOC109121105 [Solanum lycopersicum] Length = 48 Score = 63.5 bits (153), Expect = 2e-10 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = +1 Query: 133 WGRCSKQVRQQRTRLYIIWRCAVLLLCWHD 222 W CSKQVRQQR RLYIIWRC VLLLCWHD Sbjct: 19 WQGCSKQVRQQRARLYIIWRCTVLLLCWHD 48 >XP_012092285.1 PREDICTED: uncharacterized protein LOC105650027 [Jatropha curcas] Length = 46 Score = 63.2 bits (152), Expect = 2e-10 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 133 WGRCSKQVRQQRTRLYIIWRCAVLLLCWHD 222 W R SKQ+R+QRTRLYIIWRCAV+LLCWHD Sbjct: 17 WQRFSKQIREQRTRLYIIWRCAVMLLCWHD 46 >KJB23129.1 hypothetical protein B456_004G082900, partial [Gossypium raimondii] Length = 90 Score = 64.3 bits (155), Expect = 3e-10 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +1 Query: 133 WGRCSKQVRQQRTRLYIIWRCAVLLLCWHD 222 W RCSKQ+R+QR RLYI+WRC VLLLCWHD Sbjct: 61 WQRCSKQIREQRARLYIVWRCTVLLLCWHD 90