BLASTX nr result
ID: Glycyrrhiza33_contig00006329
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00006329 (302 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004087497.1 PREDICTED: peroxisomal coenzyme A diphosphatase N... 53 3e-06 >XP_004087497.1 PREDICTED: peroxisomal coenzyme A diphosphatase NUDT7 isoform X2 [Nomascus leucogenys] Length = 223 Score = 53.1 bits (126), Expect = 3e-06 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -3 Query: 276 LTPPLPSSIIVSLLRPSQKLSRCQHYASCTAYGTV 172 L PPLPS++IVS LR QK SRCQH+A CTA GT+ Sbjct: 68 LAPPLPSAMIVSFLRSPQKQSRCQHHAPCTACGTM 102