BLASTX nr result
ID: Glycyrrhiza33_contig00005998
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza33_contig00005998 (366 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004494120.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 1e-17 XP_015953262.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 2e-17 XP_016188447.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 2e-17 XP_003520676.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 3e-17 XP_014626882.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 85 6e-17 GAU15998.1 hypothetical protein TSUD_338690 [Trifolium subterran... 82 6e-16 XP_014496328.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 6e-16 KYP70960.1 Pentatricopeptide repeat-containing protein At5g03800... 82 9e-16 OAY42813.1 hypothetical protein MANES_08G017700 [Manihot esculenta] 82 9e-16 XP_017409907.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 2e-15 XP_007162829.1 hypothetical protein PHAVU_001G184400g [Phaseolus... 81 2e-15 XP_010098867.1 hypothetical protein L484_022634 [Morus notabilis... 81 2e-15 XP_018836182.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 2e-15 XP_015898557.1 PREDICTED: pentatricopeptide repeat-containing pr... 80 4e-15 CDP15329.1 unnamed protein product [Coffea canephora] 79 1e-14 XP_011094448.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 4e-14 XP_015580518.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 5e-14 CAN82063.1 hypothetical protein VITISV_016431 [Vitis vinifera] 77 7e-14 XP_002277923.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 7e-14 CBI30210.3 unnamed protein product, partial [Vitis vinifera] 77 7e-14 >XP_004494120.1 PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Cicer arietinum] XP_004494121.1 PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Cicer arietinum] Length = 883 Score = 87.4 bits (215), Expect = 1e-17 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = +2 Query: 2 DCHAFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDQW 118 DCH FLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKD W Sbjct: 845 DCHTFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDHW 883 >XP_015953262.1 PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Arachis duranensis] Length = 885 Score = 86.7 bits (213), Expect = 2e-17 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +2 Query: 2 DCHAFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDQW 118 DCH FLKYVS+VTKRDIFLRDSSGFHCFSNGQCSCKD W Sbjct: 847 DCHTFLKYVSVVTKRDIFLRDSSGFHCFSNGQCSCKDYW 885 >XP_016188447.1 PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Arachis ipaensis] Length = 888 Score = 86.7 bits (213), Expect = 2e-17 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +2 Query: 2 DCHAFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDQW 118 DCH FLKYVS+VTKRDIFLRDSSGFHCFSNGQCSCKD W Sbjct: 850 DCHTFLKYVSVVTKRDIFLRDSSGFHCFSNGQCSCKDYW 888 >XP_003520676.1 PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Glycine max] KRH67807.1 hypothetical protein GLYMA_03G189000 [Glycine max] Length = 874 Score = 86.3 bits (212), Expect = 3e-17 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = +2 Query: 2 DCHAFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDQW 118 DCHAFLKY SIVTKRDIFLRDSSGFHCFSNGQCSCKD W Sbjct: 836 DCHAFLKYASIVTKRDIFLRDSSGFHCFSNGQCSCKDCW 874 >XP_014626882.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g03800-like [Glycine max] Length = 430 Score = 85.1 bits (209), Expect = 6e-17 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +2 Query: 2 DCHAFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDQW 118 DCH+FLKY SIVTKRDIFLRDSSGFHCFSNGQCSCKD W Sbjct: 392 DCHSFLKYASIVTKRDIFLRDSSGFHCFSNGQCSCKDCW 430 >GAU15998.1 hypothetical protein TSUD_338690 [Trifolium subterraneum] Length = 622 Score = 82.4 bits (202), Expect = 6e-16 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +2 Query: 2 DCHAFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDQW 118 DCH FLKYVSIVTKRDI LRDSSGFHCFS+GQCSCKD W Sbjct: 584 DCHTFLKYVSIVTKRDIILRDSSGFHCFSHGQCSCKDLW 622 >XP_014496328.1 PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Vigna radiata var. radiata] Length = 873 Score = 82.4 bits (202), Expect = 6e-16 Identities = 35/39 (89%), Positives = 35/39 (89%) Frame = +2 Query: 2 DCHAFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDQW 118 DCH FLKY SIVTKRDIFLRDSSGFHCFS GQCSCKD W Sbjct: 835 DCHTFLKYASIVTKRDIFLRDSSGFHCFSGGQCSCKDCW 873 >KYP70960.1 Pentatricopeptide repeat-containing protein At5g03800 family [Cajanus cajan] Length = 688 Score = 82.0 bits (201), Expect = 9e-16 Identities = 35/39 (89%), Positives = 35/39 (89%) Frame = +2 Query: 2 DCHAFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDQW 118 DCH FLKY SIVTKRDIFLRDSSGFHCF NGQCSCKD W Sbjct: 650 DCHEFLKYASIVTKRDIFLRDSSGFHCFYNGQCSCKDCW 688 >OAY42813.1 hypothetical protein MANES_08G017700 [Manihot esculenta] Length = 912 Score = 82.0 bits (201), Expect = 9e-16 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = +2 Query: 2 DCHAFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDQW 118 DCH+FLKYVS+VT+R+IF+RD+SGFHCFSNGQCSCKD W Sbjct: 874 DCHSFLKYVSVVTRREIFVRDASGFHCFSNGQCSCKDYW 912 >XP_017409907.1 PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Vigna angularis] KOM29240.1 hypothetical protein LR48_Vigan641s002800 [Vigna angularis] BAT85792.1 hypothetical protein VIGAN_04337900 [Vigna angularis var. angularis] Length = 873 Score = 81.3 bits (199), Expect = 2e-15 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +2 Query: 2 DCHAFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDQW 118 DCH FLKY SIVTKRDIF+RDSSGFHCFS GQCSCKD W Sbjct: 835 DCHTFLKYASIVTKRDIFVRDSSGFHCFSGGQCSCKDCW 873 >XP_007162829.1 hypothetical protein PHAVU_001G184400g [Phaseolus vulgaris] ESW34823.1 hypothetical protein PHAVU_001G184400g [Phaseolus vulgaris] Length = 874 Score = 81.3 bits (199), Expect = 2e-15 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +2 Query: 2 DCHAFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDQW 118 DCH FLKY SIVTK+DIFLRDSSGFHCFS GQCSCKD W Sbjct: 836 DCHTFLKYASIVTKKDIFLRDSSGFHCFSGGQCSCKDCW 874 >XP_010098867.1 hypothetical protein L484_022634 [Morus notabilis] EXB75955.1 hypothetical protein L484_022634 [Morus notabilis] Length = 911 Score = 81.3 bits (199), Expect = 2e-15 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +2 Query: 2 DCHAFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDQW 118 DCH F KYVSIVT+RDIFLRD+SGFHCFS+GQCSCKD W Sbjct: 873 DCHTFFKYVSIVTRRDIFLRDTSGFHCFSSGQCSCKDYW 911 >XP_018836182.1 PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Juglans regia] Length = 916 Score = 80.9 bits (198), Expect = 2e-15 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 2 DCHAFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDQW 118 DCH FLKYVS+VTKR+IFLRDSSGFHCF GQCSCKD W Sbjct: 878 DCHTFLKYVSVVTKREIFLRDSSGFHCFCGGQCSCKDYW 916 >XP_015898557.1 PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Ziziphus jujuba] Length = 912 Score = 80.1 bits (196), Expect = 4e-15 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +2 Query: 2 DCHAFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDQW 118 DCH FLKYVSIVT+R+IF+RD+SGFHCFS+GQCSCKD W Sbjct: 874 DCHTFLKYVSIVTRREIFVRDASGFHCFSSGQCSCKDYW 912 >CDP15329.1 unnamed protein product [Coffea canephora] Length = 905 Score = 78.6 bits (192), Expect = 1e-14 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = +2 Query: 2 DCHAFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDQW 118 DCH F K VS+VTKR+I++RDSSGFHCFSNG+CSCKDQW Sbjct: 867 DCHTFFKNVSVVTKREIYVRDSSGFHCFSNGKCSCKDQW 905 >XP_011094448.1 PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Sesamum indicum] Length = 903 Score = 77.4 bits (189), Expect = 4e-14 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +2 Query: 2 DCHAFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDQW 118 DCH F KYVS+VTKR+I +RDSSGFHCF+NG+CSCKD W Sbjct: 865 DCHTFFKYVSVVTKREIHVRDSSGFHCFANGECSCKDYW 903 >XP_015580518.1 PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Ricinus communis] Length = 782 Score = 77.0 bits (188), Expect = 5e-14 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +2 Query: 2 DCHAFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDQW 118 DCH FLKYVS VTKR+I +RD+SGFHCFSNG CSCKD W Sbjct: 743 DCHTFLKYVSAVTKREIIVRDTSGFHCFSNGHCSCKDYW 781 >CAN82063.1 hypothetical protein VITISV_016431 [Vitis vinifera] Length = 755 Score = 76.6 bits (187), Expect = 7e-14 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = +2 Query: 2 DCHAFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDQW 118 DCH FLKYVSIVT R+IFLRD+SG HCF NGQCSCKD W Sbjct: 717 DCHTFLKYVSIVTGREIFLRDASGHHCFLNGQCSCKDYW 755 >XP_002277923.1 PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Vitis vinifera] Length = 882 Score = 76.6 bits (187), Expect = 7e-14 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = +2 Query: 2 DCHAFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDQW 118 DCH FLKYVSIVT R+IFLRD+SG HCF NGQCSCKD W Sbjct: 844 DCHTFLKYVSIVTGREIFLRDASGHHCFLNGQCSCKDYW 882 >CBI30210.3 unnamed protein product, partial [Vitis vinifera] Length = 900 Score = 76.6 bits (187), Expect = 7e-14 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = +2 Query: 2 DCHAFLKYVSIVTKRDIFLRDSSGFHCFSNGQCSCKDQW 118 DCH FLKYVSIVT R+IFLRD+SG HCF NGQCSCKD W Sbjct: 862 DCHTFLKYVSIVTGREIFLRDASGHHCFLNGQCSCKDYW 900